Clone LP10814 Report

Search the DGRC for LP10814

Clone and Library Details

Library:LP
Tissue Source:Drosophila melanogaster larval-early pupal
Created by:Ling Hong
Date Registered:1998-06-11
Comments:Sized fractionated cDNAs were directly ligated into pOT2. Plasmid cDNA library.
Original Plate Number:108
Well:14
Vector:pOT2
Associated Gene/TranscriptCG32690-RA
Protein status:LP10814.pep: Inserted from web
Sequenced Size:888

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG2968 2002-01-01 Sim4 clustering to Release 2
CG32690 2003-01-01 Sim4 clustering to Release 3
CG32690 2008-04-29 Picked prior to 5.5
CG32690 2008-08-15 Release 5.9 accounting
CG32690 2008-12-18 5.12 accounting

Clone Sequence Records

LP10814.complete Sequence

888 bp assembled on 2008-05-27

GenBank Submission: BT032851.1

> LP10814.complete
TCGCATTTCTCGAACAAGTTACAGAAATGTATCAAAATTTTTTCAGTTAA
AAAACTACATTGCCGACGAAATGTCGGCACAAGGCTTGGTTCCTCGCCCG
AATCCGAGGAATCCAAACCAGGAAACAACGTTGATAATGATCGACAAAAT
TACTCACTACTCATGAACACGATGCTCCATAACTGCCGGACGAGCACCAA
TCGGCGACCCAGTTCCGGAGGATCATCAAGCTGCAAAACCCATGACACTA
GACTGTAAAAGTACACATTGTTACAGCAGCAGTGCACAAGGCTTGATTCC
TCGCCCGAATCCGAGGAATCTAAGCCAGGAAACGACGTTTGATCATGATT
CGCCACGTGTGGGACTAGATTTTTCACTACCTATGAACACGATGCTTTCT
TTATACGACACTGGATGGTAACACGATGGTAACACGAATTGATACTGCGT
TGATTTGGATCGTTGAACACAGTTACATACGTTACATTTTGCACGTTTTC
TATTGCGATTTACAATTAGTTTTGCCAGTTCACACAATCTCCTTTGATTA
TTGTAAGCCAATTAATACTACTTACAGTGACAATACTAAAATACAGCTGT
GTATGAAAGTGGACAATACACAAAACCATACACTACAACTAAAACAAAAA
CAAATCAGAATTTGAAAGTGGACTAGAAGTAACACTTATTACACAGACAC
CGAATGTTATAACAAATACACTGAAAACACACAAATAAAATATTGTATAC
GTCATCCCAAAGAATAAAAACATCGATTAATTGAGCTAAAAAAAAAAAAA
AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA
AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA

LP10814.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 16:52:27
Subject Length Description Subject Range Query Range Score Percent Strand
CG32690-RA 831 CG32690-RA 40..831 1..792 3960 100 Plus
CG32690.b 1165 CG32690.b 40..831 1..792 3960 100 Plus
CG32690.a 1524 CG32690.a 40..831 1..792 3960 100 Plus
Blast to d_melanogaster_OreR.fa performed 2014-11-26 20:33:17
Subject Length Description Subject Range Query Range Score Percent Strand
chrX 22417052 chrX 10096163..10096895 55..787 3650 99.9 Plus
chrX 22417052 chrX 9449611..9449974 398..55 970 86.3 Minus
chrX 22417052 chrX 9449255..9449408 784..647 310 83.1 Minus
chrX 22417052 chrX 9449382..9449506 614..493 290 84 Minus
chrX 22417052 chrX 10096044..10096097 1..54 270 100 Plus
chrX 22417052 chrX 9449572..9449724 217..77 235 78.4 Minus
chrX 22417052 chrX 10096185..10096240 284..339 220 92.9 Plus
chrX 22417052 chrX 10096392..10096447 77..132 220 92.9 Plus
Blast to dmel-all-CDS-r6.02.fasta performed on 2014-11-26 20:33:14 has no hits.
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 19:54:44 has no hits.
Blast to dmel-all-transcript-r6.02.fasta performed on 2014-11-26 20:33:13 has no hits.
Blast to dmel-all-translation-r6.02.fasta performed on 2014-11-26 20:33:15 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 20:33:11
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 10204557..10205294 55..792 3690 100 Plus
X 23542271 X 9557898..9558261 398..55 970 86.3 Minus
X 23542271 X 9557536..9557695 790..647 325 83.1 Minus
X 23542271 X 9557669..9557793 614..493 290 84 Minus
X 23542271 X 10204438..10204491 1..54 270 100 Plus
X 23542271 X 9557859..9558011 217..77 235 78.4 Minus
X 23542271 X 10204579..10204634 284..339 220 92.9 Plus
X 23542271 X 10204786..10204841 77..132 220 92.9 Plus
3L 28110227 3L 15899746..15899784 788..826 195 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 18:49:03
Subject Length Description Subject Range Query Range Score Percent Strand
X 23527363 X 10212655..10213392 55..792 3690 100 Plus
X 23527363 X 9566148..9566359 265..55 735 90.5 Minus
X 23527363 X 9565996..9566131 398..262 510 92.7 Minus
X 23527363 X 9565634..9565730 790..695 310 89.6 Minus
X 23527363 X 10212536..10212589 1..54 270 100 Plus
X 23527363 X 9565743..9565793 697..647 225 96 Minus
X 23527363 X 9565833..9565891 551..493 220 91.5 Minus
X 23527363 X 9566045..9566109 141..77 220 89.2 Minus
X 23527363 X 9566270..9566337 352..284 185 86.9 Minus
X 23527363 X 9565957..9566025 217..149 180 84 Minus
X 23527363 X 9565767..9565821 614..560 155 85.4 Minus
Blast to na_te.dros performed on 2014-11-26 20:33:12 has no hits.

LP10814.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2014-11-26 21:31:04 Download gff for LP10814.complete
Subject Subject Range Query Range Percent Splice Strand
chrX 10096163..10096895 55..787 99   Plus
chrX 10096044..10096097 1..54 100 -> Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 19:40:49 Download gff for LP10814.complete
Subject Subject Range Query Range Percent Splice Strand
CG32690-RA 1..240 426..665 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 14:45:18 Download gff for LP10814.complete
Subject Subject Range Query Range Percent Splice Strand
CG32690-RA 1..240 426..665 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 17:09:05 Download gff for LP10814.complete
Subject Subject Range Query Range Percent Splice Strand
CG32690-RA 1..665 1..665 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 14:45:19 Download gff for LP10814.complete
Subject Subject Range Query Range Percent Splice Strand
CG32690-RA 1..665 1..665 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 21:31:04 Download gff for LP10814.complete
Subject Subject Range Query Range Percent Splice Strand
X 10204557..10205289 55..787 100   Plus
X 10204438..10204491 1..54 100 -> Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 21:31:04 Download gff for LP10814.complete
Subject Subject Range Query Range Percent Splice Strand
X 10204557..10205289 55..787 100   Plus
X 10204438..10204491 1..54 100 -> Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 21:31:04 Download gff for LP10814.complete
Subject Subject Range Query Range Percent Splice Strand
X 10204557..10205289 55..787 100   Plus
X 10204438..10204491 1..54 100 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 01:06:50 Download gff for LP10814.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 10098590..10099322 55..787 100   Plus
arm_X 10098471..10098524 1..54 100 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 01:06:50 Download gff for LP10814.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 10098590..10099322 55..787 100   Plus
arm_X 10098471..10098524 1..54 100 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 01:06:50 Download gff for LP10814.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 10098590..10099322 55..787 100   Plus
arm_X 10098471..10098524 1..54 100 -> Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 12:21:41 Download gff for LP10814.complete
Subject Subject Range Query Range Percent Splice Strand
X 10212655..10213387 55..787 100   Plus
X 10212536..10212589 1..54 100 -> Plus

LP10814.hyp Sequence

Translation from 0 to 257

> LP10814.hyp
SHFSNKLQKCIKIFSVKKLHCRRNVGTRLGSSPESEESKPGNNVDNDRQN
YSLLMNTMLHNCRTSTNRRPSSGGSSSCKTHDTRL*
Sequence LP10814.hyp has no blast hits.

LP10814.pep Sequence

Translation from 425 to 664

> LP10814.pep
MVTRIDTALIWIVEHSYIRYILHVFYCDLQLVLPVHTISFDYCKPINTTY
SDNTKIQLCMKVDNTQNHTLQLKQKQIRI*
Sequence LP10814.pep has no blast hits.