Clone LP11186 Report

Search the DGRC for LP11186

Clone and Library Details

Library:LP
Tissue Source:Drosophila melanogaster larval-early pupal
Created by:Ling Hong
Date Registered:1998-06-11
Comments:Sized fractionated cDNAs were directly ligated into pOT2. Plasmid cDNA library.
Original Plate Number:111
Well:86
Vector:pOT2
Associated Gene/TranscriptCG8372-RB
Protein status:LP11186.pep: gold
Sequenced Size:828

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG8372-RB 2009-06-22 Replacement based on scoring

Clone Sequence Records

LP11186.complete Sequence

828 bp assembled on 2009-07-31

GenBank Submission: BT089021.1

> LP11186.complete
CTTTATTTTCTCCTTATCGTACAATTAAAGCCCAATTGGAATTGTTAGCG
ACTCGTTTCATGGGCATTACGGCCGGGAAGACCGTGAGTGACTGTTCTTG
TGGCTTCCCCGCACAAATATCAACCTAATACAGTGTAATAATGTCGACAA
ACCCAAGTCCGCAGCGGCAACAGTCCGAGGACGTTCAGATCTCGATGGCC
AGTTCCGGAGGAGGAGCCGGCAATGGCGTTCCGGATAGACTGCCTCCGAT
CAACGTAAAGGACCAACGCTTCCCCTACTGCATCGTTTGGACTCCCATTC
CGGTTCTCACCTGGCTGATGCCCATGATCGGACATATGGGCATTTGCACT
TCGTCCGGTGTGATTCGTGACTTCGCCGGCCCCTACTTCGTATCAGAGGA
CAACATGGCCTTTGGAAGACCCACCCGGTACATAAGGTTGCACCCCAAGC
ACATGGTGGGCGGCAGTTACGCCTGGGACGAGGCGGTCTCCAAAGCATCT
GTGCTCTACGGCACCCGCATCCACAATATCTTCTGTGACAACTGCCACTC
GCATGTGGCAACGGCACTCATCTACATGCGCTACTACGACAGCACCGCAT
GGAACATGATTATCCTCAGCATGTGGCTCTTTGTCTGCGGCCGCTACGTC
GGAATAGGGGGTTTTATTAAGACCTGGCTGCCGTTTGCCATTCTCCTGTC
CATCTTCACCATTCTGGGCATCTATTTTTAATATTCATATCTATATCAAA
TGCTATCAATGTACAAATCTATGTACATATGACGTCCAATAAAGGATTCA
TTCATTTATGTAAAAAAAAAAAAAAAAA

LP11186.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 16:27:34
Subject Length Description Subject Range Query Range Score Percent Strand
CG8372-RB 843 CG8372-RB 33..843 1..811 4055 100 Plus
CG8372-RA 863 CG8372-RA 170..824 158..812 3275 100 Plus
CG8372-RA 863 CG8372-RA 87..169 1..83 415 100 Plus
Blast to d_melanogaster_OreR.fa performed 2014-11-26 21:49:32
Subject Length Description Subject Range Query Range Score Percent Strand
chr2L 23010047 chr2L 8211019..8211829 811..1 4025 99.8 Minus
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 21:49:30
Subject Length Description Subject Range Query Range Score Percent Strand
CG8372-RB 591 CG8372-PB 1..591 141..731 2955 100 Plus
CG8372-RA 537 CG8372-PA 1..537 195..731 2685 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 19:55:12 has no hits.
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 21:49:29
Subject Length Description Subject Range Query Range Score Percent Strand
CG8372-RB 864 CG8372-RB 54..864 1..811 4055 100 Plus
CG8372-RA 790 CG8372-RA 137..790 158..811 3270 100 Plus
CG8372-RA 790 CG8372-RA 54..136 1..83 415 100 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-26 21:49:31
Subject Length Description Subject Range Query Range Score Percent Strand
CG8372-PB 196 CG8372-PB 1..194 141..722 997 100 Plus
CG8372-PA 178 CG8372-PA 12..176 228..722 912 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 21:49:27
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 8212038..8212849 812..1 4060 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 18:22:05
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 8212038..8212849 812..1 4060 100 Minus
Blast to na_te.dros performed on 2014-11-26 21:49:28 has no hits.

LP11186.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2014-11-26 22:44:35 Download gff for LP11186.complete
Subject Subject Range Query Range Percent Splice Strand
chr2L 8211019..8211829 1..811 99   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2009-10-19 18:12:35 Download gff for LP11186.complete
Subject Subject Range Query Range Percent Splice Strand
CG8372-RB 1..591 141..731 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 13:53:52 Download gff for LP11186.complete
Subject Subject Range Query Range Percent Splice Strand
CG8372-RB 1..591 141..731 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 05:38:44 Download gff for LP11186.complete
Subject Subject Range Query Range Percent Splice Strand
CG8372-RB 1..591 141..731 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 22:44:35 Download gff for LP11186.complete
Subject Subject Range Query Range Percent Splice Strand
CG8372-RB 1..591 141..731 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2009-07-31 14:14:27 Download gff for LP11186.complete
Subject Subject Range Query Range Percent Splice Strand
CG8372-RB 33..843 1..811 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 13:53:52 Download gff for LP11186.complete
Subject Subject Range Query Range Percent Splice Strand
CG8372-RB 33..843 1..811 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 05:38:44 Download gff for LP11186.complete
Subject Subject Range Query Range Percent Splice Strand
CG8372-RB 54..864 1..811 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 22:44:35 Download gff for LP11186.complete
Subject Subject Range Query Range Percent Splice Strand
CG8372-RB 54..864 1..811 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 22:44:35 Download gff for LP11186.complete
Subject Subject Range Query Range Percent Splice Strand
2L 8212039..8212849 1..811 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 05:38:44 Download gff for LP11186.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 8212039..8212849 1..811 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 11:44:38 Download gff for LP11186.complete
Subject Subject Range Query Range Percent Splice Strand
2L 8212039..8212849 1..811 100   Minus

LP11186.pep Sequence

Translation from 140 to 730

> LP11186.pep
MSTNPSPQRQQSEDVQISMASSGGGAGNGVPDRLPPINVKDQRFPYCIVW
TPIPVLTWLMPMIGHMGICTSSGVIRDFAGPYFVSEDNMAFGRPTRYIRL
HPKHMVGGSYAWDEAVSKASVLYGTRIHNIFCDNCHSHVATALIYMRYYD
STAWNMIILSMWLFVCGRYVGIGGFIKTWLPFAILLSIFTILGIYF*

LP11186.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2014-11-28 08:56:03
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF14628-PA 196 GF14628-PA 1..196 1..196 802 78.1 Plus
Blast to dere-all-translation-r1.3.fasta performed 2014-11-28 08:56:05
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG23467-PA 196 GG23467-PA 1..196 1..196 888 88.8 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2014-11-28 08:56:06
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH10250-PA 190 GH10250-PA 4..190 6..196 728 70.7 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 08:56:02
Subject Length Description Subject Range Query Range Score Percent Strand
CG8372-PB 196 CG8372-PB 1..196 1..196 1072 100 Plus
CG8372-PA 178 CG8372-PA 1..178 19..196 982 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2014-11-28 08:56:07
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI15419-PA 190 GI15419-PA 4..190 6..196 728 66.5 Plus
Blast to dper-all-translation-r1.3.fasta performed 2014-11-28 08:56:08
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL19395-PA 195 GL19395-PA 15..195 8..196 758 72.5 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2014-11-28 08:56:09
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA21028-PA 195 GA21028-PA 15..195 8..196 758 72.5 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2014-11-28 08:56:10
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM13133-PA 196 GM13133-PA 1..196 1..196 993 94.4 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2014-11-28 08:56:11
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD22432-PA 196 GD22432-PA 1..196 1..196 1011 95.4 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2014-11-28 08:56:12
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ17280-PA 193 GJ17280-PA 3..193 2..196 712 70.3 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2014-11-28 08:56:14
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK14979-PA 202 GK14979-PA 16..202 8..196 823 79.4 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2014-11-28 08:56:15
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE11124-PA 196 GE11124-PA 1..196 1..196 907 90.8 Plus

LP11186.hyp Sequence

Translation from 140 to 730

> LP11186.hyp
MSTNPSPQRQQSEDVQISMASSGGGAGNGVPDRLPPINVKDQRFPYCIVW
TPIPVLTWLMPMIGHMGICTSSGVIRDFAGPYFVSEDNMAFGRPTRYIRL
HPKHMVGGSYAWDEAVSKASVLYGTRIHNIFCDNCHSHVATALIYMRYYD
STAWNMIILSMWLFVCGRYVGIGGFIKTWLPFAILLSIFTILGIYF*

LP11186.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:13:05
Subject Length Description Subject Range Query Range Score Percent Strand
CG8372-PB 196 CG8372-PB 1..196 1..196 1072 100 Plus
CG8372-PA 178 CG8372-PA 1..178 19..196 982 100 Plus