Clone LP11584 Report

Search the DGRC for LP11584

Clone and Library Details

Library:LP
Tissue Source:Drosophila melanogaster larval-early pupal
Created by:Ling Hong
Date Registered:1998-06-11
Comments:Sized fractionated cDNAs were directly ligated into pOT2. Plasmid cDNA library.
Original Plate Number:115
Well:84
Vector:pOT2
Associated Gene/TranscriptFbp1-RA
Protein status:LP11584.pep: gold
Preliminary Size:3174
Sequenced Size:3428

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG17285 2002-01-01 Sim4 clustering to Release 2
CG17285 2002-05-18 Blastp of sequenced clone
Fbp1 2008-04-29 Release 5.5 accounting
Fbp1 2008-08-15 Release 5.9 accounting
Fbp1 2008-12-18 5.12 accounting

Clone Sequence Records

LP11584.complete Sequence

3428 bp (3428 high quality bases) assembled on 2002-05-18

GenBank Submission: AY119088

> LP11584.complete
CTGCTGGTCTGTGTTGCAGCAAGTTAAATCCATCTGAGCTCTCCAATCCT
TCAGTTTCTCAATTGATCAGTTAACATCAATAGTTGTTACAATCAAGATG
AACAGAATCATGCTGTTGGTGGCCTTTGCGGCCGGCGTTGTGGCTGCTGG
AAGGATAACTACGAATCAGGACAGGGTCCAGGGTATTGACCGCATGTCCT
TGGAGGATCTGCAGCTCCAAAAGTTTATCCTGGATATCGTCCAGAATATT
CGTCAGCCTCTACAGCAGAGTGAGCTCATCAATCTAGATGTGGGTCTGAT
TGCAGACAGTCAGCGTTATCGTGGCGGCATTGATAAGGTGATGCATAACG
TCATCGATCTGGATCGCCAGCGTCGCCTCCTCGACGAGCACCAGGTGTAC
TCCGTGGGTCGTTTGGAGCATGTGCAGCAGCTGCGTGGCATATACCGCCT
GCTGGCTCGCGCCCAGGACTTTGACACCCTTCGCCGTAATGTGGTCTACC
TGCGCCGTAACATTAACCCTGTCCTGCTGGTTAATGCCTTGGCTCTGGCC
ATTCGCGATCGTGAGGACACTCAAGCTCTGATCGTGCCCGCTGTCCAGGA
GCTGCTCCCCGAACTGTATCTGGATGAGGAAGTGATTCAGCAGGTGCGCA
GCGTCCTAAGGGAACAAACCCAGCGCCCATCGCTCATGGACATCGTGGGT
ATGCGCCAGCGGGCTATGAACCCAGTGATGAGCATCCTGATGCCCTGGAG
GGAGATCCACATGCAGATGGCTCTAAGGAAACAGCAGAACATCCAGAACG
TTTTGGGCCAGAAACGCGTCGTTGTCCGTGCCGAGAACCAGGGACAGGTT
GAGGGCACCTCTCTGCTGACGGACGATATTGAGTTGCAGAACTTTGTTCA
AAATCTCATACAGGAACTTGCCCTTCTGGAGGATGTTACTCAGTTGGAGC
AGAGCCAATTGATCAACAATGATCAACGTGAAGAGCAATGGGTCGGTCGT
CAGCGCGTGCAGTACCAAGATAACAACCAGGAAAGAGATCTGGGTCAGGA
TGTAGACACTGGACGCCTACTCCGTGTGAGTCGCCGCCGCCTTCTGGAGC
AACAGGATGAATATCAGGGTCAGAACATCTATGGAAACCAAAAGGATCGT
TTCCAGCGTCTCCTCCGCCGGGATGACGACAACGACGACAATGATGACGA
TGATGATCAGGATATTCGCATGGGTCGTGTCCAGCTGCAGCGTGGTATCA
GCCAGGGAGGTCTCCGCATTGGAGGAGCTCATAACCTGCCCACCGTTAGC
GTGAACAGTGACCGTCTGCTTCACGTGAGCCGTCGCCGTTTGAACGCCAT
CCAACAAGATCAGCAGCAGGATCAGCTGAACGGTCGCCAGCGTTTCATGG
GTTTGGTGAGAGGAGACCGCCTCAGTGAGGGTCGTCGTGTTGGTCAGCTG
GATGATGTGCGTCAGGAGCGTCAGAACAACTGGCAGAAGCAGGACTACAT
CTTGACACAAGGTCGCACTTTCGGAGTCCAGCAGGAGCGTCAAAACTATG
CCGATCAGTTGGAGAGCGTGAGCCGCGACGACGAGCGATTGGTGCATATT
AACCGACGCCGCCTCAACCAGGACAACCAGGACATCCAGCAACAACAGAT
GCATTTTCCCCGCAGGATTAACTCCATTGGCGAGGGTCGCCGCGTCATGG
GTGAGCGCCCCATCCAAGATGAGGACATTCTGAAGCTAATCCGCGGCGAA
AACCGTCTGAAGCTGATGACCGATGATGAGATCCTTGAGATGCTGCAAAG
GAACCGCCAGCAGCGTCTGCAAAAGCACCAGAACGATGATGATGACGATG
TCAACGATGACGATGTGAATGTGGTGCACCGACAGGGACTACGAAGCCGC
CGCAGCCTTCCCAATCTCCGTCAGCAAAACAACCGCCTCAGCGAAATTGT
CCTGCACAATCTTCGCCAGCTGGTCGCACGTCTTAACCAGGAAAGCATCG
CCCAGGGACAGCTGATCGAAGAGCAGCAGCAGTTGATCAACAATCCCCGC
CTGACGCAATCCGAGCGATATGCCCTCCGCTTGAACCAAATCCGAATCAA
TTCCCAGCGCAGCCGTCAAGTCCTCGCCCAGATCGGCCAGATTGAGCAGC
GTATCCAGGAGGTTATTGGTCAGGTGCTGAACCAGGTGAATGTCAACTCG
CTGCGTGGCCAGGTAATCGATCAACGCCAAGTGGAATCCCTGATCGCCGA
TGTACTGCTGGGTCGCCTTGGTCAGGTTGGCATCATGACCATTATCCGCC
AGGTGGTCCAGGACAACAACATTGAGCAAATCGATCGTACTGGCTTGGGC
ATCCGCCTCAGCGATCCCGTCGTGCAGTACACCCTGCGCCGGATTGTGAG
GATCGTGGACGAACAGCGTGAACAAATCCTTGGAGGCTACCGCCAGGAGC
AACTGCAGATGCGCGGTGTTTCGATCAACGATGTTCGTGTGGATAAACTG
CGCACTCGCATCGAGGAGCACGAATTGGACCTGAGCAACTTGGTCGAGCA
GCAGGTTCAGGGCATCCAGCAGGAGATTGTGGGACGCCAGCGTCGCCTCA
ACAACAAGGCCTTCACCATTGACATGGACATCACTTCGGATCAGGATCAG
GATGCTATTATTCGCATCTTCCTGGGACCCGCAGAGGATCAACAGGGAAG
GCAAGGAGCTTCCCTGGATGAGCGCCGACGTGACTTCGTTCTTCTCGATG
CCATCCAAGTGCAGCTGGAGAATGGACGCAACCGCATTCATCGCAGGTCC
ATCGATATCCCCTGGACAACTAGCGATGTGACGCCCCTGGTGGAGATCTA
CCGCCAAGTGATGCTGCAATTGAAGGGTCAGCAGGCGCAACAGGTCGTGG
GTATCCAACAGCTGGTCGGCGAGAACGGACGCTTCCCCCAGCACTTGCTG
CTACCCCGTGGAAGGCCCGAGGGTCTCCCCATGCAACTCCTGGTCGTGGT
TTCTCCTCTGGTTGAGCTGCAGGTTCAGGACGTCGTTCCCGCTATCACCA
TTGGCATTGGCTCCGCCTCTCTTCGTGATGCCCGCCCATTGGGTTATCCT
CTGGACCGGCCCATCCATAACGAGCAGGAGCTCCTGCAGTTGACCAATGT
CCTGCTTCAGGATGTGGTCATCATTCAGGAGAACTAAGTTCCCAATACGA
AGTTCCAAATATGTTAAACCGATCGTCTGGCCAGCTGCTATTCAATGGAC
CTATCCGAAAATCCCCTGTCGAACCCTAGTTTTAATTAATCGAATCTAAA
TCAATTTAGCAAAATAGCAAAATGTTAAATACTCTTGTAATTCATATATA
TATATATATATATTTGTCATTAAAGTTTTTTGCAAGCAATGCAATGCAAT
CAAGCATTAAAAAAAAAAAAAAAAAAAA

LP11584.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 19:01:16
Subject Length Description Subject Range Query Range Score Percent Strand
Fbp1-RA 3570 Fbp1-RA 116..3526 1..3411 17055 100 Plus
Fbp1.a 3433 Fbp1.a 29..3433 1..3411 16940 99.8 Plus
Fbp1-RB 3468 Fbp1-RB 245..3468 188..3411 16120 100 Plus
Fbp1-RB 3468 Fbp1-RB 1..185 4..188 925 100 Plus
Blast to d_melanogaster_OreR.fa performed 2014-11-26 19:53:39
Subject Length Description Subject Range Query Range Score Percent Strand
chr3L 24539361 chr3L 14084752..14087972 3408..188 15805 99.4 Minus
chr3L 24539361 chr3L 14088032..14088219 188..1 940 100 Minus
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 19:53:34
Subject Length Description Subject Range Query Range Score Percent Strand
Fbp1-RA 3090 CG17285-PA 1..3090 98..3187 15450 100 Plus
Fbp1-RD 3084 CG17285-PD 1..3084 98..3187 15325 99.8 Plus
Fbp1-RB 2994 CG17285-PB 1..2994 194..3187 14970 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 19:55:33 has no hits.
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 19:53:32
Subject Length Description Subject Range Query Range Score Percent Strand
Fbp1-RA 3405 CG17285-RA 1..3405 4..3408 17025 100 Plus
Fbp1-RD 3399 CG17285-RD 1..3399 4..3408 16900 99.8 Plus
Fbp1-RB 3465 CG17285-RB 245..3465 188..3408 16105 100 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-26 19:53:38
Subject Length Description Subject Range Query Range Score Percent Strand
Fbp1-PA 1029 CG17285-PA 1..1029 98..3184 4208 100 Plus
Fbp1-PD 1027 CG17285-PD 1..1027 98..3184 4185 99.8 Plus
Fbp1-PB 997 CG17285-PB 1..997 194..3184 4115 100 Plus
Lsp1alpha-PA 816 CG2559-PA 346..780 1925..3172 265 26.6 Plus
Lsp1gamma-PA 772 CG6821-PA 315..729 1931..3115 231 26.6 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 19:53:29
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 14094586..14097809 3411..188 16120 100 Minus
3L 28110227 3L 14097869..14098056 188..1 940 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 20:33:05
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28103327 3L 14087686..14090909 3411..188 16120 100 Minus
3L 28103327 3L 14090969..14091156 188..1 940 100 Minus
Blast to na_te.dros performed on 2014-11-26 19:53:31 has no hits.

LP11584.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2014-11-26 20:48:08 Download gff for LP11584.complete
Subject Subject Range Query Range Percent Splice Strand
chr3L 14088032..14088219 1..188 100   Minus
chr3L 14084752..14087971 189..3408 97 <- Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 19:41:33 Download gff for LP11584.complete
Subject Subject Range Query Range Percent Splice Strand
Fbp1-RA 1..3090 98..3187 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 17:41:48 Download gff for LP11584.complete
Subject Subject Range Query Range Percent Splice Strand
Fbp1-RA 1..3090 98..3187 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-03 22:20:03 Download gff for LP11584.complete
Subject Subject Range Query Range Percent Splice Strand
Fbp1-RA 1..3090 98..3187 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 18:33:52 Download gff for LP11584.complete
Subject Subject Range Query Range Percent Splice Strand
Fbp1-RA 1..3090 98..3187 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 20:48:08 Download gff for LP11584.complete
Subject Subject Range Query Range Percent Splice Strand
Fbp1-RA 1..3090 98..3187 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 21:15:54 Download gff for LP11584.complete
Subject Subject Range Query Range Percent Splice Strand
Fbp1-RA 1..3408 1..3408 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 17:41:48 Download gff for LP11584.complete
Subject Subject Range Query Range Percent Splice Strand
Fbp1-RA 1..3408 1..3408 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-03 22:20:03 Download gff for LP11584.complete
Subject Subject Range Query Range Percent Splice Strand
Fbp1-RA 1..3405 4..3408 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 18:33:52 Download gff for LP11584.complete
Subject Subject Range Query Range Percent Splice Strand
Fbp1-RA 1..3408 1..3408 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 20:48:08 Download gff for LP11584.complete
Subject Subject Range Query Range Percent Splice Strand
Fbp1-RA 1..3405 4..3408 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 20:48:08 Download gff for LP11584.complete
Subject Subject Range Query Range Percent Splice Strand
3L 14097869..14098056 1..188 100   Minus
3L 14094589..14097808 189..3408 100 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-03 22:20:03 Download gff for LP11584.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 14090969..14091156 1..188 100   Minus
arm_3L 14087689..14090908 189..3408 100 <- Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 15:06:14 Download gff for LP11584.complete
Subject Subject Range Query Range Percent Splice Strand
3L 14090969..14091156 1..188 100   Minus
3L 14087689..14090908 189..3408 100 <- Minus

LP11584.hyp Sequence

Translation from 97 to 3186

> LP11584.hyp
MNRIMLLVAFAAGVVAAGRITTNQDRVQGIDRMSLEDLQLQKFILDIVQN
IRQPLQQSELINLDVGLIADSQRYRGGIDKVMHNVIDLDRQRRLLDEHQV
YSVGRLEHVQQLRGIYRLLARAQDFDTLRRNVVYLRRNINPVLLVNALAL
AIRDREDTQALIVPAVQELLPELYLDEEVIQQVRSVLREQTQRPSLMDIV
GMRQRAMNPVMSILMPWREIHMQMALRKQQNIQNVLGQKRVVVRAENQGQ
VEGTSLLTDDIELQNFVQNLIQELALLEDVTQLEQSQLINNDQREEQWVG
RQRVQYQDNNQERDLGQDVDTGRLLRVSRRRLLEQQDEYQGQNIYGNQKD
RFQRLLRRDDDNDDNDDDDDQDIRMGRVQLQRGISQGGLRIGGAHNLPTV
SVNSDRLLHVSRRRLNAIQQDQQQDQLNGRQRFMGLVRGDRLSEGRRVGQ
LDDVRQERQNNWQKQDYILTQGRTFGVQQERQNYADQLESVSRDDERLVH
INRRRLNQDNQDIQQQQMHFPRRINSIGEGRRVMGERPIQDEDILKLIRG
ENRLKLMTDDEILEMLQRNRQQRLQKHQNDDDDDVNDDDVNVVHRQGLRS
RRSLPNLRQQNNRLSEIVLHNLRQLVARLNQESIAQGQLIEEQQQLINNP
RLTQSERYALRLNQIRINSQRSRQVLAQIGQIEQRIQEVIGQVLNQVNVN
SLRGQVIDQRQVESLIADVLLGRLGQVGIMTIIRQVVQDNNIEQIDRTGL
GIRLSDPVVQYTLRRIVRIVDEQREQILGGYRQEQLQMRGVSINDVRVDK
LRTRIEEHELDLSNLVEQQVQGIQQEIVGRQRRLNNKAFTIDMDITSDQD
QDAIIRIFLGPAEDQQGRQGASLDERRRDFVLLDAIQVQLENGRNRIHRR
SIDIPWTTSDVTPLVEIYRQVMLQLKGQQAQQVVGIQQLVGENGRFPQHL
LLPRGRPEGLPMQLLVVVSPLVELQVQDVVPAITIGIGSASLRDARPLGY
PLDRPIHNEQELLQLTNVLLQDVVIIQEN*

LP11584.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:13:53
Subject Length Description Subject Range Query Range Score Percent Strand
Fbp1-PA 1029 CG17285-PA 1..1029 1..1029 5153 100 Plus
Fbp1-PD 1027 CG17285-PD 1..1027 1..1029 5130 99.8 Plus
Fbp1-PB 997 CG17285-PB 1..997 33..1029 4999 100 Plus
Lsp1alpha-PA 816 CG2559-PA 346..780 610..1025 358 28.1 Plus
Lsp1gamma-PA 772 CG6821-PA 315..729 612..1006 333 28 Plus
Lsp1alpha-PA 816 CG2559-PA 33..192 38..198 192 26.1 Plus

LP11584.pep Sequence

Translation from 97 to 3186

> LP11584.pep
MNRIMLLVAFAAGVVAAGRITTNQDRVQGIDRMSLEDLQLQKFILDIVQN
IRQPLQQSELINLDVGLIADSQRYRGGIDKVMHNVIDLDRQRRLLDEHQV
YSVGRLEHVQQLRGIYRLLARAQDFDTLRRNVVYLRRNINPVLLVNALAL
AIRDREDTQALIVPAVQELLPELYLDEEVIQQVRSVLREQTQRPSLMDIV
GMRQRAMNPVMSILMPWREIHMQMALRKQQNIQNVLGQKRVVVRAENQGQ
VEGTSLLTDDIELQNFVQNLIQELALLEDVTQLEQSQLINNDQREEQWVG
RQRVQYQDNNQERDLGQDVDTGRLLRVSRRRLLEQQDEYQGQNIYGNQKD
RFQRLLRRDDDNDDNDDDDDQDIRMGRVQLQRGISQGGLRIGGAHNLPTV
SVNSDRLLHVSRRRLNAIQQDQQQDQLNGRQRFMGLVRGDRLSEGRRVGQ
LDDVRQERQNNWQKQDYILTQGRTFGVQQERQNYADQLESVSRDDERLVH
INRRRLNQDNQDIQQQQMHFPRRINSIGEGRRVMGERPIQDEDILKLIRG
ENRLKLMTDDEILEMLQRNRQQRLQKHQNDDDDDVNDDDVNVVHRQGLRS
RRSLPNLRQQNNRLSEIVLHNLRQLVARLNQESIAQGQLIEEQQQLINNP
RLTQSERYALRLNQIRINSQRSRQVLAQIGQIEQRIQEVIGQVLNQVNVN
SLRGQVIDQRQVESLIADVLLGRLGQVGIMTIIRQVVQDNNIEQIDRTGL
GIRLSDPVVQYTLRRIVRIVDEQREQILGGYRQEQLQMRGVSINDVRVDK
LRTRIEEHELDLSNLVEQQVQGIQQEIVGRQRRLNNKAFTIDMDITSDQD
QDAIIRIFLGPAEDQQGRQGASLDERRRDFVLLDAIQVQLENGRNRIHRR
SIDIPWTTSDVTPLVEIYRQVMLQLKGQQAQQVVGIQQLVGENGRFPQHL
LLPRGRPEGLPMQLLVVVSPLVELQVQDVVPAITIGIGSASLRDARPLGY
PLDRPIHNEQELLQLTNVLLQDVVIIQEN*

LP11584.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2014-11-27 22:01:57
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF25207-PA 1014 GF25207-PA 1..1014 1..1029 3038 67.1 Plus
Dana\GF14363-PA 772 GF14363-PA 315..746 612..1025 442 28.6 Plus
Dana\GF18920-PA 791 GF18920-PA 321..757 610..1027 429 27.8 Plus
Dana\GF16081-PA 791 GF16081-PA 321..759 610..1029 428 27.7 Plus
Dana\GF23589-PA 700 GF23589-PA 403..692 754..1027 316 26.7 Plus
Dana\GF18920-PA 791 GF18920-PA 10..192 11..198 240 25.5 Plus
Dana\GF16081-PA 791 GF16081-PA 1..192 1..198 235 25.8 Plus
Dana\GF14363-PA 772 GF14363-PA 1..191 1..198 210 25.3 Plus
Blast to dere-all-translation-r1.3.fasta performed 2014-11-27 22:01:59
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG13736-PA 1031 GG13736-PA 1..1031 1..1029 3487 77.8 Plus
Dere\GG17724-PA 805 GG17724-PA 335..773 610..1029 456 29.2 Plus
Dere\GG14690-PA 772 GG14690-PA 315..744 612..1023 420 26.5 Plus
Dere\GG24756-PA 791 GG24756-PA 321..759 610..1029 410 27 Plus
Dere\GG15559-PA 837 GG15559-PA 542..829 756..1027 318 27.3 Plus
Dere\GG17724-PA 805 GG17724-PA 10..192 11..198 218 26.6 Plus
Dere\GG14690-PA 772 GG14690-PA 2..191 3..198 210 25 Plus
Dere\GG24756-PA 791 GG24756-PA 7..192 7..198 207 23.4 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2014-11-27 22:02:01
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH16348-PA 1227 GH16348-PA 703..1227 485..1029 1251 52 Plus
Dgri\GH16348-PA 1227 GH16348-PA 1..499 1..566 952 46 Plus
Dgri\GH23643-PA 788 GH23643-PA 317..754 610..1027 429 27.1 Plus
Dgri\GH10465-PA 774 GH10465-PA 316..751 612..1029 427 27.9 Plus
Dgri\GH23649-PA 771 GH23649-PA 304..739 612..1027 426 26.5 Plus
Dgri\GH21006-PA 702 GH21006-PA 431..694 781..1027 307 28.3 Plus
Dgri\GH23643-PA 788 GH23643-PA 10..187 11..193 213 25.7 Plus
Dgri\GH23649-PA 771 GH23649-PA 2..181 3..193 207 25.4 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 22:01:55
Subject Length Description Subject Range Query Range Score Percent Strand
Fbp1-PA 1029 CG17285-PA 1..1029 1..1029 5153 100 Plus
Fbp1-PD 1027 CG17285-PD 1..1027 1..1029 5130 99.8 Plus
Fbp1-PB 997 CG17285-PB 1..997 33..1029 4999 100 Plus
Lsp1alpha-PA 816 CG2559-PA 346..780 610..1025 358 28.1 Plus
Lsp1gamma-PA 772 CG6821-PA 315..729 612..1006 333 28 Plus
Lsp1alpha-PA 816 CG2559-PA 33..192 38..198 192 26.1 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2014-11-27 22:02:02
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI11539-PA 1135 GI11539-PA 514..1135 415..1029 1257 47.4 Plus
Dmoj\GI18059-PA 773 GI18059-PA 316..747 612..1025 423 27.7 Plus
Dmoj\GI23074-PA 788 GI23074-PA 317..754 610..1027 423 27.3 Plus
Dmoj\GI20647-PA 701 GI20647-PA 430..693 781..1027 315 29 Plus
Dmoj\GI13762-PA 669 GI13762-PA 51..306 39..305 283 30.8 Plus
Dmoj\GI23074-PA 788 GI23074-PA 10..187 11..193 222 26.8 Plus
Blast to dper-all-translation-r1.3.fasta performed 2014-11-27 22:02:04
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL24835-PA 1005 GL24835-PA 1..1005 1..1029 2791 60.8 Plus
Dper\GL23266-PA 566 GL23266-PA 96..534 610..1029 417 26.6 Plus
Dper\GL26223-PA 773 GL26223-PA 315..747 612..1026 412 27.4 Plus
Dper\GL17278-PA 701 GL17278-PA 430..693 781..1027 322 28.3 Plus
Dper\GL25294-PA 642 GL25294-PA 44..259 41..274 247 28.2 Plus
Dper\GL26223-PA 773 GL26223-PA 1..176 1..183 195 24.6 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2014-11-27 22:02:06
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA14441-PA 1006 GA14441-PA 1..1006 1..1029 2793 61.1 Plus
Dpse\GA27203-PA 787 GA27203-PA 317..755 610..1029 419 26.8 Plus
Dpse\GA28082-PA 773 GA28082-PA 315..747 612..1026 412 27.4 Plus
Dpse\GA24161-PA 701 GA24161-PA 430..693 781..1027 322 28.3 Plus
Dpse\GA20824-PA 646 GA20824-PA 44..303 41..310 239 27.2 Plus
Dpse\GA27203-PA 787 GA27203-PA 12..192 13..198 214 24.7 Plus
Dpse\GA28082-PA 773 GA28082-PA 1..176 1..183 195 24.6 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2014-11-27 22:02:08
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM24558-PA 1027 GM24558-PA 1..1027 1..1029 4593 94.9 Plus
Dsec\GM14308-PA 772 GM14308-PA 209..744 518..1023 420 24.1 Plus
Dsec\GM16778-PA 789 GM16778-PA 319..757 610..1029 387 27.6 Plus
Dsec\GM25327-PA 828 GM25327-PA 533..820 756..1027 326 27.2 Plus
Dsec\GM11568-PA 452 GM11568-PA 1..192 1..198 230 25.3 Plus
Dsec\GM14308-PA 772 GM14308-PA 13..191 14..198 196 24.9 Plus
Dsec\GM16778-PA 789 GM16778-PA 33..192 38..198 196 22.4 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2014-11-27 22:02:09
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD12631-PA 1028 GD12631-PA 1..1028 1..1029 4630 95.7 Plus
Dsim\Lsp1gamma-PA 772 GD13544-PA 209..744 518..1023 425 24.3 Plus
Dsim\GD17082-PA 788 GD17082-PA 318..754 610..1027 409 28.4 Plus
Dsim\GD23056-PA 754 GD23056-PA 284..722 610..1029 382 27.7 Plus
Dsim\GD14358-PA 749 GD14358-PA 454..741 756..1027 332 27.6 Plus
Dsim\Lsp1gamma-PA 772 GD13544-PA 1..191 1..198 201 24.2 Plus
Dsim\GD17082-PA 788 GD17082-PA 18..165 38..198 181 24.2 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2014-11-27 22:02:11
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ11558-PA 1297 GJ11558-PA 615..1297 380..1029 1414 47.4 Plus
Dvir\GJ11558-PA 1297 GJ11558-PA 1..609 1..578 1138 46.5 Plus
Dvir\GJ22590-PA 788 GJ22590-PA 317..754 610..1027 421 27.1 Plus
Dvir\GJ16457-PA 773 GJ16457-PA 316..747 612..1025 414 27.5 Plus
Dvir\GJ21616-PA 701 GJ21616-PA 430..693 781..1027 308 29.3 Plus
Dvir\GJ13752-PA 661 GJ13752-PA 10..234 4..216 291 33.5 Plus
Dvir\GJ22590-PA 788 GJ22590-PA 33..187 38..193 207 25.6 Plus
Dvir\GJ16457-PA 773 GJ16457-PA 1..180 1..186 203 25.8 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2014-11-27 22:02:14
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK17147-PA 1113 GK17147-PA 528..1113 449..1029 1400 57.8 Plus
Dwil\GK17147-PA 1113 GK17147-PA 1..461 1..484 885 51.3 Plus
Dwil\GK11112-PA 787 GK11112-PA 317..751 610..1025 444 28 Plus
Dwil\GK11980-PA 787 GK11980-PA 317..751 610..1025 444 28 Plus
Dwil\GK18671-PA 772 GK18671-PA 313..746 610..1025 429 28.3 Plus
Dwil\GK19679-PA 701 GK19679-PA 430..693 781..1027 325 29.3 Plus
Dwil\GK11112-PA 787 GK11112-PA 10..192 11..198 227 24.5 Plus
Dwil\GK11980-PA 787 GK11980-PA 10..192 11..198 227 24.5 Plus
Dwil\GK18671-PA 772 GK18671-PA 1..179 1..186 192 25.8 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2014-11-27 22:02:16
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE20030-PA 1022 GE20030-PA 1..1022 1..1029 4246 88.8 Plus
Dyak\GE21052-PA 772 GE21052-PA 209..744 518..1023 427 24.6 Plus
Dyak\GE17210-PA 791 GE17210-PA 321..759 610..1029 415 27 Plus
Dyak\GE17014-PA 815 GE17014-PA 345..783 610..1029 398 27.7 Plus
Dyak\GE21884-PA 737 GE21884-PA 442..729 756..1027 330 27.9 Plus
Dyak\GE17014-PA 815 GE17014-PA 1..207 1..213 233 24.9 Plus
Dyak\GE17210-PA 791 GE17210-PA 10..192 11..198 212 23.9 Plus
Dyak\GE21052-PA 772 GE21052-PA 2..173 3..180 208 26.4 Plus