Clone LP12067 Report

Search the DGRC for LP12067

Clone and Library Details

Library:LP
Tissue Source:Drosophila melanogaster larval-early pupal
Created by:Ling Hong
Date Registered:1998-06-11
Comments:Sized fractionated cDNAs were directly ligated into pOT2. Plasmid cDNA library.
Original Plate Number:120
Well:67
Vector:pOT2
Associated Gene/Transcriptpip-RC
Protein status:LP12067.pep: gold
Sequenced Size:1387

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
pip-RC 2010-07-13 Manual selection by Sue Celniker

Clone Sequence Records

LP12067.complete Sequence

1387 bp assembled on 2011-01-03

GenBank Submission: BT125857.1

> LP12067.complete
CCGAGCTCTACGGACGTCTATATCTCTAAGTCTTCGAATCGTGAATCGGA
ACTCAAGTGAACCCAAGTGCCGACCGGAAAATTCTTTCGGCCAAGAAAGG
TCTTCGAGAACTAAGATCTCAAGCGATTGTGTTTTTTGTGTAATTGACAT
TGGATGTCTCTGAACGCCGAGCGATCGTACAAAATGAAACTGCGCGATGT
GGAAAATGCCTTCAAATACCGGCGCATACCGTATCCCAAGCGTTCCGTCG
AGCTGATCGCCCTGCTGGCTATTTCGTGCACCTTCTTCCTGTTCATGCAC
ACCAACAAACTGAACAGTCGCCTCAAGGAGATGGAGGTGAAGCTGCAGCC
ATCGGAGTTTTCGGCCCTCGGTCTAACGGGCAACCACATCAGCGGACACG
ATGCGGGCAAGCACGATGACATCAACACCCTGCACGGCACCTACCAATAT
CTGAAGAGCACTGGCCAGCTGTGGCGATTAAATCCGAAATTTCTAAATAA
CACCAAGTTTCACTTTCGCGATATTATCTTCTACAATCGAGTTCCCAAGA
CGGGCAGTGAAACGCTGATCGAGTTGATGATTCAACTTGGAAAAAAGAAC
GACTTTCAGAACGAAAGGTCTCCGTTTTCGAAACCCACTGGAATGTACTG
GGATGTGAAGCGGCAAAAGCAGGAAGCCACGCGCATCCTGGAGTTGCAGG
AGGAACCAGCCTTTGTCTATGTAGAGCACATGAACTACATGAACATTCGC
CCCTTTCACCTACCCCAACCAATCTACATCAACATGATTCGAGACCCCGT
AGAACGAGTGATCAGCTGGTTCTACTATAAACGCACTCCCTGGAACTCTG
TCAAAATGTACAAGGTGACGGGGAAATTTCAGAATCGCACCCACTACACC
AAGAACTTTGAGGAATGCGTCCTTACACACGATCCGGAATGTCGATATGA
CTACGGACTTCTGTTCAAGGACGATTCTGCCGATCACAAGCGTCAGAGCC
TGTTCTTCTGCGGACACTCCCCCATTTGCGAACCCTTCAATACACCGGCG
GCAATTGCGAGGGCCAAGCAAAACGTAGAGCGAGATTTCTCAGTGGTTGG
TTCCTGGGAGGATACGAATGTCACTTTGACAGTGCTCGAGCACTATATAC
CGCGATTCTTCAAGGGCACTATGGAGCTGTACTATGAACCCAATATCGGT
CTGGCCTTTAAGAAGGCGAATATCAACCCCTGGAAGCCGAAAATTAGCGA
GCGAATCAAGCAAATAATGCGGGCTAACTTCACTCAGGAATACGAATTTT
ATTACTTTTGCAAGCAGCGCTTGTATCGCCAATACTTTGCAATAAATAAG
CAATTGCACTTCTGAAAAAAAAAAAAAAAAAAAAAAA

LP12067.complete Blast Records

Blast to d_melanogaster_OreR.fa performed 2014-11-27 16:40:57
Subject Length Description Subject Range Query Range Score Percent Strand
chr3L 24539361 chr3L 19298244..19298564 786..466 1605 100 Minus
chr3L 24539361 chr3L 19297943..19298188 1031..786 1230 100 Minus
chr3L 24539361 chr3L 19326806..19327047 242..1 1195 99.6 Minus
chr3L 24539361 chr3L 19297489..19297667 1364..1186 895 100 Minus
chr3L 24539361 chr3L 19308271..19308438 409..242 840 100 Minus
chr3L 24539361 chr3L 19297729..19297883 1186..1032 775 100 Minus
chr3L 24539361 chr3L 19302643..19302701 468..410 295 100 Minus
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 16:40:53
Subject Length Description Subject Range Query Range Score Percent Strand
pip-RC 1212 CG9614-PC 1..1211 154..1364 6055 100 Plus
pip-RF 1194 CG9614-PF 1..318 154..471 1590 100 Plus
pip-RM 879 CG9614-PM 1..317 154..470 1585 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 16:40:52
Subject Length Description Subject Range Query Range Score Percent Strand
pip-RC 1397 CG9614-RC 27..1390 1..1364 6820 100 Plus
pip-RF 1441 CG9614-RF 27..497 1..471 2355 100 Plus
pip-RM 2975 CG9614-RM 27..496 1..470 2350 100 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 16:40:55
Subject Length Description Subject Range Query Range Score Percent Strand
pip-PC 403 CG9614-PC 1..403 154..1362 2182 100 Plus
pip-PG 407 CG9614-PG 1..396 154..1347 1247 61.1 Plus
pip-PA 413 CG9614-PA 1..393 154..1341 1185 59.8 Plus
pip-PD 418 CG9614-PD 1..393 154..1344 1177 59.1 Plus
pip-PH 405 CG9614-PH 1..396 154..1350 1156 56.9 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 16:40:49
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 19308756..19309076 786..466 1605 100 Minus
3L 28110227 3L 19308455..19308700 1031..786 1230 100 Minus
3L 28110227 3L 19337342..19337583 242..1 1210 100 Minus
3L 28110227 3L 19307999..19308179 1366..1186 905 100 Minus
3L 28110227 3L 19318784..19318951 409..242 840 100 Minus
3L 28110227 3L 19308241..19308395 1186..1032 775 100 Minus
3L 28110227 3L 19313156..19313214 468..410 295 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 23:04:17
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28103327 3L 19301856..19302176 786..466 1605 100 Minus
3L 28103327 3L 19301555..19301800 1031..786 1230 100 Minus
3L 28103327 3L 19330442..19330683 242..1 1210 100 Minus
3L 28103327 3L 19301099..19301279 1366..1186 905 100 Minus
3L 28103327 3L 19311884..19312051 409..242 840 100 Minus
3L 28103327 3L 19301341..19301495 1186..1032 775 100 Minus
3L 28103327 3L 19306256..19306314 468..410 295 100 Minus
3L 28103327 3L 19292945..19293014 827..758 140 80 Minus
Blast to na_te.dros performed on 2014-11-27 16:40:51 has no hits.

LP12067.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2014-11-27 17:56:07 Download gff for LP12067.complete
Subject Subject Range Query Range Percent Splice Strand
chr3L 19326806..19327047 1..242 99   Minus
chr3L 19308271..19308437 243..409 100 <- Minus
chr3L 19302643..19302701 410..468 100 <- Minus
chr3L 19298244..19298561 469..786 100 <- Minus
chr3L 19297943..19298187 787..1031 100 <- Minus
chr3L 19297729..19297883 1032..1186 100 <- Minus
chr3L 19297489..19297666 1187..1364 100 <- Minus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-01-05 09:00:55 Download gff for LP12067.complete
Subject Subject Range Query Range Percent Splice Strand
pip-RC 1..1211 154..1364 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-03 20:36:54 Download gff for LP12067.complete
Subject Subject Range Query Range Percent Splice Strand
pip-RC 1..1212 154..1365 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 17:56:07 Download gff for LP12067.complete
Subject Subject Range Query Range Percent Splice Strand
pip-RC 1..1212 154..1365 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-01-05 09:00:55 Download gff for LP12067.complete
Subject Subject Range Query Range Percent Splice Strand
pip-RC 17..1380 1..1364 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-03 20:36:54 Download gff for LP12067.complete
Subject Subject Range Query Range Percent Splice Strand
pip-RC 27..1390 1..1364 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 17:56:07 Download gff for LP12067.complete
Subject Subject Range Query Range Percent Splice Strand
pip-RC 27..1390 1..1364 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 17:56:07 Download gff for LP12067.complete
Subject Subject Range Query Range Percent Splice Strand
3L 19337342..19337583 1..242 100   Minus
3L 19318784..19318950 243..409 100 <- Minus
3L 19313156..19313214 410..468 100 <- Minus
3L 19308756..19309073 469..786 100 <- Minus
3L 19308455..19308699 787..1031 100 <- Minus
3L 19308241..19308395 1032..1186 100 <- Minus
3L 19308001..19308178 1187..1364 100 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-03 20:36:54 Download gff for LP12067.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 19330442..19330683 1..242 100   Minus
arm_3L 19311884..19312050 243..409 100 <- Minus
arm_3L 19306256..19306314 410..468 100 <- Minus
arm_3L 19301856..19302173 469..786 100 <- Minus
arm_3L 19301555..19301799 787..1031 100 <- Minus
arm_3L 19301341..19301495 1032..1186 100 <- Minus
arm_3L 19301101..19301278 1187..1364 100 <- Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 19:53:22 Download gff for LP12067.complete
Subject Subject Range Query Range Percent Splice Strand
3L 19330442..19330683 1..242 100   Minus
3L 19311884..19312050 243..409 100 <- Minus
3L 19306256..19306314 410..468 100 <- Minus
3L 19301856..19302173 469..786 100 <- Minus
3L 19301555..19301799 787..1031 100 <- Minus
3L 19301341..19301495 1032..1186 100 <- Minus
3L 19301101..19301278 1187..1364 100 <- Minus

LP12067.pep Sequence

Translation from 153 to 1364

> LP12067.pep
MSLNAERSYKMKLRDVENAFKYRRIPYPKRSVELIALLAISCTFFLFMHT
NKLNSRLKEMEVKLQPSEFSALGLTGNHISGHDAGKHDDINTLHGTYQYL
KSTGQLWRLNPKFLNNTKFHFRDIIFYNRVPKTGSETLIELMIQLGKKND
FQNERSPFSKPTGMYWDVKRQKQEATRILELQEEPAFVYVEHMNYMNIRP
FHLPQPIYINMIRDPVERVISWFYYKRTPWNSVKMYKVTGKFQNRTHYTK
NFEECVLTHDPECRYDYGLLFKDDSADHKRQSLFFCGHSPICEPFNTPAA
IARAKQNVERDFSVVGSWEDTNVTLTVLEHYIPRFFKGTMELYYEPNIGL
AFKKANINPWKPKISERIKQIMRANFTQEYEFYYFCKQRLYRQYFAINKQ
LHF*

LP12067.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2014-11-28 12:36:46
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF10766-PA 311 GF10766-PA 14..309 106..401 1364 80.7 Plus
Dana\GF10764-PA 407 GF10764-PA 1..400 1..401 1157 57.4 Plus
Dana\GF10771-PA 319 GF10771-PA 10..298 105..396 639 45.2 Plus
Dana\GF10768-PA 851 GF10768-PA 251..545 93..398 636 45 Plus
Dana\GF10765-PA 342 GF10765-PA 33..318 113..398 618 43.3 Plus
Blast to dere-all-translation-r1.3.fasta performed 2014-11-28 12:36:48
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG13411-PA 396 GG13411-PA 1..386 11..397 1067 54.6 Plus
Dere\GG13413-PA 516 GG13413-PA 212..496 109..396 635 46.2 Plus
Dere\GG13413-PA 516 GG13413-PA 98..209 101..212 506 82.1 Plus
Dere\GG21631-PA 349 GG21631-PA 74..282 124..347 238 28.9 Plus
Dere\GG13413-PA 516 GG13413-PA 1..116 139..248 205 39.5 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2014-11-28 12:36:49
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH14407-PA 421 GH14407-PA 1..399 1..403 1117 55.5 Plus
Dgri\GH14411-PA 314 GH14411-PA 12..303 105..398 684 48.8 Plus
Dgri\GH14410-PA 312 GH14410-PA 10..301 105..398 679 48.5 Plus
Dgri\GH14414-PA 306 GH14414-PA 4..288 109..396 639 46.2 Plus
Dgri\GH14412-PA 303 GH14412-PA 4..294 106..399 625 44.3 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 12:36:45
Subject Length Description Subject Range Query Range Score Percent Strand
pip-PC 403 CG9614-PC 1..403 1..403 2182 100 Plus
pip-PG 407 CG9614-PG 1..396 1..398 1247 61.1 Plus
pip-PA 413 CG9614-PA 1..393 1..396 1185 59.8 Plus
pip-PD 418 CG9614-PD 1..393 1..397 1177 59.1 Plus
pip-PH 405 CG9614-PH 1..396 1..399 1156 56.9 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2014-11-28 12:36:50
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI13536-PA 406 GI13536-PA 1..399 1..399 1117 56 Plus
Dmoj\GI13540-PA 304 GI13540-PA 2..293 105..398 696 49.5 Plus
Dmoj\GI13539-PA 314 GI13539-PA 1..289 105..397 673 47.1 Plus
Dmoj\GI13544-PA 306 GI13544-PA 4..288 109..396 637 46.2 Plus
Dmoj\GI13537-PA 371 GI13537-PA 53..349 107..403 610 43.2 Plus
Blast to dper-all-translation-r1.3.fasta performed 2014-11-28 12:36:51
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL20901-PA 477 GL20901-PA 99..469 30..401 975 52.8 Plus
Dper\GL20909-PA 532 GL20909-PA 223..512 104..396 644 45.4 Plus
Dper\GL20906-PA 471 GL20906-PA 3..291 105..397 636 44.7 Plus
Dper\GL20903-PA 154 GL20903-PA 4..150 106..252 616 73.5 Plus
Dper\GL20907-PA 322 GL20907-PA 26..313 109..399 610 42.7 Plus
Dper\GL20909-PA 532 GL20909-PA 19..214 169..391 334 35.7 Plus
Dper\GL20906-PA 471 GL20906-PA 284..459 93..265 319 41.3 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2014-11-28 12:36:53
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA28236-PA 301 GA28236-PA 4..299 106..401 1344 79.4 Plus
Dpse\GA28234-PA 376 GA28234-PA 1..368 1..401 1072 54.3 Plus
Dpse\GA28238-PA 1157 GA28238-PA 284..589 93..398 683 47.8 Plus
Dpse\GA28240-PA 308 GA28240-PA 4..288 109..396 636 45.9 Plus
Dpse\GA28238-PA 1157 GA28238-PA 3..291 105..397 632 44.7 Plus
Dpse\GA28238-PA 1157 GA28238-PA 599..886 109..399 610 42.7 Plus
Dpse\GA28237-PA 307 GA28237-PA 10..299 105..399 513 38.4 Plus
Dpse\GA28238-PA 1157 GA28238-PA 897..1140 106..351 498 41.3 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2014-11-28 12:36:54
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM19105-PA 697 GM19105-PA 400..697 106..403 1561 94 Plus
Dsec\GM14872-PA 262 GM14872-PA 1..262 142..403 1355 93.1 Plus
Dsec\GM18995-PA 407 GM18995-PA 1..397 1..397 1094 54.3 Plus
Dsec\GM14880-PA 308 GM14880-PA 4..288 109..396 637 46.2 Plus
Dsec\GM14876-PA 270 GM14876-PA 1..259 138..398 614 47 Plus
Dsec\GM19105-PA 697 GM19105-PA 91..387 102..398 611 42.2 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2014-11-28 12:36:55
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD12286-PA 397 GD12286-PA 1..387 11..397 1042 53.2 Plus
Dsim\GD12287-PA 516 GD12287-PA 212..496 109..396 634 46.2 Plus
Dsim\GD12287-PA 516 GD12287-PA 98..209 101..212 560 92 Plus
Dsim\GD21759-PA 349 GD21759-PA 14..282 28..347 239 25.1 Plus
Dsim\GD12287-PA 516 GD12287-PA 1..116 139..248 202 38.7 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2014-11-28 12:36:56
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ11895-PA 406 GJ11895-PA 1..396 1..397 1119 56.4 Plus
Dvir\GJ11897-PA 299 GJ11897-PA 4..297 106..401 1049 63.5 Plus
Dvir\GJ11899-PA 616 GJ11899-PA 315..605 106..398 672 48 Plus
Dvir\GJ11899-PA 616 GJ11899-PA 5..292 106..397 653 46.3 Plus
Dvir\GJ11902-PA 306 GJ11902-PA 4..288 109..396 637 46.2 Plus
Dvir\GJ11896-PA 392 GJ11896-PA 74..370 107..403 604 41.9 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2014-11-28 12:36:57
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK19555-PA 668 GK19555-PA 372..666 106..401 1125 67.2 Plus
Dwil\GK19566-PA 410 GK19566-PA 1..398 1..397 1113 55.1 Plus
Dwil\GK19608-PA 616 GK19608-PA 9..299 106..398 697 50.5 Plus
Dwil\GK19630-PA 301 GK19630-PA 4..288 109..396 640 46.6 Plus
Dwil\GK19587-PA 319 GK19587-PA 7..294 106..397 621 44.6 Plus
Dwil\GK19555-PA 668 GK19555-PA 75..359 114..398 596 43.4 Plus
Dwil\GK19608-PA 616 GK19608-PA 301..613 82..400 577 41.1 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2014-11-28 12:36:59
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE22506-PA 968 GE22506-PA 400..658 106..364 1315 90 Plus
Dyak\GE22507-PA 821 GE22507-PA 1..223 142..364 1123 88.8 Plus
Dyak\GE22505-PA 351 GE22505-PA 29..340 85..397 654 42.8 Plus
Dyak\GE22927-PA 308 GE22927-PA 4..288 109..396 637 46.2 Plus
Dyak\GE22508-PA 1311 GE22508-PA 1007..1291 109..396 634 46.2 Plus
Dyak\GE22507-PA 821 GE22507-PA 509..796 106..397 626 44.2 Plus
Dyak\GE22506-PA 968 GE22506-PA 91..392 102..403 606 42.2 Plus
Dyak\GE22506-PA 968 GE22506-PA 657..965 105..399 500 37.6 Plus
Dyak\GE22507-PA 821 GE22507-PA 222..509 105..397 494 38.9 Plus

LP12067.hyp Sequence

Translation from 153 to 1362

> LP12067.hyp
MSLNAERSYKMKLRDVENAFKYRRIPYPKRSVELIALLAISCTFFLFMHT
NKLNSRLKEMEVKLQPSEFSALGLTGNHISGHDAGKHDDINTLHGTYQYL
KSTGQLWRLNPKFLNNTKFHFRDIIFYNRVPKTGSETLIELMIQLGKKND
FQNERSPFSKPTGMYWDVKRQKQEATRILELQEEPAFVYVEHMNYMNIRP
FHLPQPIYINMIRDPVERVISWFYYKRTPWNSVKMYKVTGKFQNRTHYTK
NFEECVLTHDPECRYDYGLLFKDDSADHKRQSLFFCGHSPICEPFNTPAA
IARAKQNVERDFSVVGSWEDTNVTLTVLEHYIPRFFKGTMELYYEPNIGL
AFKKANINPWKPKISERIKQIMRANFTQEYEFYYFCKQRLYRQYFAINKQ
LHF

LP12067.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 17:19:19
Subject Length Description Subject Range Query Range Score Percent Strand
pip-PC 403 CG9614-PC 1..403 1..403 2182 100 Plus
pip-PG 407 CG9614-PG 1..396 1..398 1247 61.1 Plus
pip-PA 413 CG9614-PA 1..393 1..396 1185 59.8 Plus
pip-PD 418 CG9614-PD 1..393 1..397 1177 59.1 Plus
pip-PH 405 CG9614-PH 1..396 1..399 1156 56.9 Plus