Clone LP12150 Report

Search the DGRC for LP12150

Clone and Library Details

Library:LP
Tissue Source:Drosophila melanogaster larval-early pupal
Created by:Ling Hong
Date Registered:1998-06-11
Comments:Sized fractionated cDNAs were directly ligated into pOT2. Plasmid cDNA library.
Original Plate Number:121
Well:50
Vector:pOT2
Associated Gene/TranscriptRab27-RB
Protein status:LP12150.pep: gold
Sequenced Size:1134

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
Rab27-RB 2010-11-11 Gleaning Pick By Joe Carlson

Clone Sequence Records

LP12150.complete Sequence

1134 bp assembled on 2010-12-06

GenBank Submission: BT125812.1

> LP12150.complete
AACAGGTCGGGCAGCGCACCGCCCAGAGGATCCACTGCGTTGCATCCGCA
GCATCCGCACAGCCTCGGAGTTTTCGAAGTCCTCGTGGGTCGCTTGTTTT
CGTTTAGCAAACCTCTGCAAGGTGGTTGAAGGTCCCTTCCCCCGCGCGGA
CGAATTGCGCGCGCTAAAAATAACGGTTGCCCGCCCAGTCAGTCTGGTCC
AGTCAGCTGAATCGCAGATTCCTTCCAGATCCTTGGAGTGACGAGTGGCG
TGCGGCGTGCCGAAAGAAGCCGCCTTGGGCGCCAAAGTCGACGGCGGGCG
TCGGAGCAGAAATGCGTGCCGCGCCTCCTGAGCCTGAGCCTCTGCAATTA
GCCGGATCCGGTGAACAGTTCCTCGTCCTGGGCGACTCCGGCGTGGGAAA
GACCTGTCTCCTCTACCAGTACACGGATGGCCGGTTCCACACCCAGTTCA
TCTCCACTGTGGGCATCGACTTCCGCGAAAAGCGGCTGCTGTACAACTCC
CGCGGACGCCGCCACCGCATCCACCTGCAGATCTGGGACACCGCCGGACA
GGAGCGCTTCCGTTCACTAACCACGGCGTTTTACCGCGACGCCATGGGTT
TCCTGCTCATCTTCGACCTGACCAGCGAGAAGAGCTTCCTGGAGACGGCC
AACTGGCTGTCGCAGCTGCGGACGCACGCCTACTCCGAGGACCCCGACGT
GGTCCTTTGCGGCAACAAGTGCGACCTGCTGCAGCTGCGCGTGGTGAGTC
GCGACCAGGTGGCGGCCCTCTGCCGACGCTACCGGCTGCCGTACATCGAG
ACGAGCGCCTGCACCGGCGCCAACGTCAAGGAGGCCGTGGAGCTGCTGGT
TGGCCGGGTCATGGAGCGGATCGAGAACGCGGCCTGCAACCGCGAGTTCT
CCCTGCTACTGACCCAGTCGCGATGCCTGCCGAACATCGCCTACGGTCAG
CCGGAGGACCTGGTGCGCCTCCACGATCGGCGAGAGGAGCCCTGCTCGCG
GCGCAACTGCCGCAACTGTTAGGTGCCATGCCCGTGGCCAAGTCACCCTG
CTTTGTTCCTTGACTCGTGTTTCCGAATCTAAGTGTGTTTCGCTGTAAAT
AAATGTTGATTGTTGAAAAAAAAAAAAAAAAAAA

LP12150.complete Blast Records

Blast to d_melanogaster_OreR.fa performed 2014-11-27 16:31:52
Subject Length Description Subject Range Query Range Score Percent Strand
chrX 22417052 chrX 1367809..1368436 1115..488 3125 99.8 Minus
chrX 22417052 chrX 1370158..1370525 368..1 1825 99.7 Minus
chrX 22417052 chrX 1368600..1368721 488..367 595 99.2 Minus
chr3R 27901430 chr3R 20650713..20650812 624..525 185 79 Minus
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 16:31:49
Subject Length Description Subject Range Query Range Score Percent Strand
Rab27-RB 711 CG14791-PB 1..711 312..1022 3540 99.9 Plus
Rab27-RC 693 CG14791-PC 38..693 367..1022 3265 99.8 Plus
RabX4-RA 642 CG31118-PA 175..274 525..624 185 79 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 16:31:47
Subject Length Description Subject Range Query Range Score Percent Strand
Rab27-RB 1466 CG14791-RB 352..1466 1..1115 5560 99.9 Plus
Rab27-RC 1564 CG14791-RC 816..1564 367..1115 3730 99.9 Plus
Rab27-RC 1564 CG14791-RC 352..719 1..368 1840 100 Plus
RabX4-RA 1416 CG31118-RA 625..724 525..624 185 79 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 16:31:51
Subject Length Description Subject Range Query Range Score Percent Strand
Rab27-PB 236 CG14791-PB 1..236 312..1019 1191 100 Plus
Rab27-PC 230 CG14791-PC 13..230 366..1019 1147 99.5 Plus
Rab8-PC 207 CG8287-PC 10..174 366..875 389 44.7 Plus
Rab8-PA 207 CG8287-PA 10..174 366..875 389 44.7 Plus
Rab10-PA 204 CG17060-PA 11..173 366..869 387 44 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 16:31:46
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 1473883..1474511 1116..488 3130 99.8 Minus
X 23542271 X 1476256..1476623 368..1 1840 100 Minus
X 23542271 X 1474675..1474796 488..367 610 100 Minus
3R 32079331 3R 24827475..24827574 624..525 185 79 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 23:03:37
Subject Length Description Subject Range Query Range Score Percent Strand
X 23527363 X 1481981..1482609 1116..488 3130 99.8 Minus
X 23527363 X 1484354..1484721 368..1 1840 100 Minus
X 23527363 X 1482773..1482894 488..367 610 100 Minus
Blast to na_te.dros performed on 2014-11-27 16:31:47 has no hits.

LP12150.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2014-11-27 17:52:56 Download gff for LP12150.complete
Subject Subject Range Query Range Percent Splice Strand
chrX 1370158..1370525 1..368 99   Minus
chrX 1368600..1368719 369..488 99 <- Minus
chrX 1367809..1368435 489..1115 99 <- Minus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2010-12-06 17:16:14 Download gff for LP12150.complete
Subject Subject Range Query Range Percent Splice Strand
Rab27-RB 1..711 312..1022 99   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-03 20:33:24 Download gff for LP12150.complete
Subject Subject Range Query Range Percent Splice Strand
Rab27-RB 1..711 312..1022 99   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 17:52:56 Download gff for LP12150.complete
Subject Subject Range Query Range Percent Splice Strand
Rab27-RB 1..711 312..1022 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2010-12-06 17:16:14 Download gff for LP12150.complete
Subject Subject Range Query Range Percent Splice Strand
Rab27-RB 308..1422 1..1115 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-03 20:33:24 Download gff for LP12150.complete
Subject Subject Range Query Range Percent Splice Strand
Rab27-RB 308..1422 1..1115 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 17:52:56 Download gff for LP12150.complete
Subject Subject Range Query Range Percent Splice Strand
Rab27-RB 352..1466 1..1115 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 17:52:56 Download gff for LP12150.complete
Subject Subject Range Query Range Percent Splice Strand
X 1476256..1476623 1..368 100   Minus
X 1474675..1474794 369..488 100 <- Minus
X 1473884..1474510 489..1115 99 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-03 20:33:24 Download gff for LP12150.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 1370289..1370656 1..368 100   Minus
arm_X 1368708..1368827 369..488 100 <- Minus
arm_X 1367917..1368543 489..1115 99 <- Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 19:52:06 Download gff for LP12150.complete
Subject Subject Range Query Range Percent Splice Strand
X 1484354..1484721 1..368 100   Minus
X 1482773..1482892 369..488 100 <- Minus
X 1481982..1482608 489..1115 99 <- Minus

LP12150.pep Sequence

Translation from 311 to 1021

> LP12150.pep
MRAAPPEPEPLQLAGSGEQFLVLGDSGVGKTCLLYQYTDGRFHTQFISTV
GIDFREKRLLYNSRGRRHRIHLQIWDTAGQERFRSLTTAFYRDAMGFLLI
FDLTSEKSFLETANWLSQLRTHAYSEDPDVVLCGNKCDLLQLRVVSRDQV
AALCRRYRLPYIETSACTGANVKEAVELLVGRVMERIENAACNREFSLLL
TQSRCLPNIAYGQPEDLVRLHDRREEPCSRRNCRNC*

LP12150.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2014-11-28 11:36:14
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF20241-PA 204 GF20241-PA 11..173 19..186 406 43.5 Plus
Dana\GF10843-PA 207 GF10843-PA 10..174 19..188 403 44.7 Plus
Dana\GF11093-PA 220 GF11093-PA 23..189 19..190 391 41.9 Plus
Dana\GF10277-PA 403 GF10277-PA 195..371 4..186 360 43.8 Plus
Dana\GF17263-PA 205 GF17263-PA 13..203 19..212 346 34.7 Plus
Blast to dere-all-translation-r1.3.fasta performed 2014-11-28 11:36:15
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG12695-PA 234 GG12695-PA 1..234 1..236 1222 97.9 Plus
Dere\GG13365-PA 207 GG13365-PA 10..174 19..188 403 44.7 Plus
Dere\GG19277-PA 204 GG19277-PA 11..162 19..175 400 46.5 Plus
Dere\GG22724-PA 220 GG22724-PA 23..189 19..190 391 41.9 Plus
Dere\GG14761-PA 205 GG14761-PA 13..203 19..212 349 34.7 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2014-11-28 11:36:17
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH24468-PA 234 GH24468-PA 13..234 19..236 925 78.7 Plus
Dgri\GH12621-PA 204 GH12621-PA 11..162 19..175 400 46.5 Plus
Dgri\GH16908-PA 207 GH16908-PA 10..174 19..188 399 44.1 Plus
Dgri\GH24197-PA 220 GH24197-PA 23..189 19..190 390 41.9 Plus
Dgri\GH20855-PA 213 GH20855-PA 10..175 19..188 350 43.4 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 11:36:12
Subject Length Description Subject Range Query Range Score Percent Strand
Rab27-PB 236 CG14791-PB 1..236 1..236 1245 100 Plus
Rab27-PC 230 CG14791-PC 13..230 19..236 1147 99.5 Plus
Rab8-PC 207 CG8287-PC 10..174 19..188 389 44.7 Plus
Rab8-PA 207 CG8287-PA 10..174 19..188 389 44.7 Plus
Rab10-PA 204 CG17060-PA 11..173 19..186 387 44 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2014-11-28 11:36:18
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI16485-PA 228 GI16485-PA 13..228 19..236 960 84 Plus
Dmoj\GI11034-PA 204 GI11034-PA 11..162 19..175 403 47.1 Plus
Dmoj\GI13664-PA 207 GI13664-PA 10..174 19..188 398 44.1 Plus
Dmoj\GI20173-PA 220 GI20173-PA 23..215 19..208 391 38.9 Plus
Dmoj\GI10714-PA 213 GI10714-PA 10..175 19..188 348 43.4 Plus
Blast to dper-all-translation-r1.3.fasta performed 2014-11-28 11:36:20
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL14374-PA 230 GL14374-PA 13..230 19..236 1029 90.5 Plus
Dper\GL15675-PA 207 GL15675-PA 10..174 19..188 401 44.7 Plus
Dper\GL17187-PA 220 GL17187-PA 23..189 19..190 391 41.9 Plus
Dper\GL13857-PA 213 GL13857-PA 10..175 19..188 350 43.4 Plus
Dper\GL27164-PA 205 GL27164-PA 13..176 19..187 343 37.3 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2014-11-28 11:36:22
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA13248-PA 230 GA13248-PA 13..230 19..236 1029 90.5 Plus
Dpse\GA23499-PA 207 GA23499-PA 10..174 19..188 401 44.7 Plus
Dpse\GA26078-PA 204 GA26078-PA 11..162 19..175 400 46.5 Plus
Dpse\GA20450-PA 220 GA20450-PA 23..189 19..190 391 41.9 Plus
Dpse\GA16022-PA 213 GA16022-PA 10..175 19..188 350 43.4 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2014-11-28 11:36:23
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM15893-PA 207 GM15893-PA 10..174 19..188 403 44.7 Plus
Dsec\GM23016-PA 204 GM23016-PA 11..162 19..175 400 46.5 Plus
Dsec\GM20500-PA 220 GM20500-PA 23..189 19..190 391 41.9 Plus
Dsec\GM15089-PA 205 GM15089-PA 13..203 19..212 349 34.7 Plus
Dsec\GM22359-PA 194 GM22359-PA 1..149 22..173 345 48.7 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2014-11-28 11:36:24
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD12244-PA 207 GD12244-PA 10..174 19..188 403 44.7 Plus
Dsim\GD19996-PA 205 GD19996-PA 13..203 19..212 349 34.7 Plus
Dsim\GD14951-PA 265 GD14951-PA 71..220 21..173 349 48.4 Plus
Dsim\GD10420-PA 213 GD10420-PA 8..172 19..188 344 40.6 Plus
Dsim\GD18265-PA 213 GD18265-PA 10..175 19..188 344 42.8 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2014-11-28 11:36:25
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ16030-PA 226 GJ16030-PA 13..226 19..236 963 85.3 Plus
Dvir\GJ15815-PA 204 GJ15815-PA 11..162 19..175 400 47.1 Plus
Dvir\GJ13999-PA 207 GJ13999-PA 10..174 19..188 398 44.1 Plus
Dvir\GJ20130-PA 220 GJ20130-PA 23..189 19..190 390 41.9 Plus
Dvir\GJ14443-PA 205 GJ14443-PA 13..203 19..212 349 34.7 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2014-11-28 11:36:27
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK16937-PA 230 GK16937-PA 13..230 19..236 952 82.4 Plus
Dwil\GK25049-PA 204 GK25049-PA 11..162 19..175 402 47.1 Plus
Dwil\GK17214-PA 207 GK17214-PA 10..174 19..188 402 44.7 Plus
Dwil\GK19661-PA 220 GK19661-PA 23..189 19..190 390 41.9 Plus
Dwil\GK20471-PA 194 GK20471-PA 2..153 21..175 348 48.4 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2014-11-28 11:36:28
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE16524-PA 234 GE16524-PA 1..234 1..236 1224 98.7 Plus
Dyak\GE22459-PA 207 GE22459-PA 10..174 19..188 403 44.7 Plus
Dyak\GE17866-PA 204 GE17866-PA 11..162 19..175 400 46.5 Plus
Dyak\GE13081-PA 220 GE13081-PA 23..189 19..190 391 41.9 Plus
Dyak\Rab1-PA 205 GE25003-PA 13..203 19..212 349 34.7 Plus

LP12150.hyp Sequence

Translation from 311 to 1021

> LP12150.hyp
MRAAPPEPEPLQLAGSGEQFLVLGDSGVGKTCLLYQYTDGRFHTQFISTV
GIDFREKRLLYNSRGRRHRIHLQIWDTAGQERFRSLTTAFYRDAMGFLLI
FDLTSEKSFLETANWLSQLRTHAYSEDPDVVLCGNKCDLLQLRVVSRDQV
AALCRRYRLPYIETSACTGANVKEAVELLVGRVMERIENAACNREFSLLL
TQSRCLPNIAYGQPEDLVRLHDRREEPCSRRNCRNC*

LP12150.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 17:16:51
Subject Length Description Subject Range Query Range Score Percent Strand
Rab27-PB 236 CG14791-PB 1..236 1..236 1245 100 Plus
Rab27-PC 230 CG14791-PC 13..230 19..236 1147 99.5 Plus
Rab8-PC 207 CG8287-PC 10..174 19..188 389 44.7 Plus
Rab8-PA 207 CG8287-PA 10..174 19..188 389 44.7 Plus
Rab10-PA 204 CG17060-PA 11..173 19..186 387 44 Plus