Clone LP13001 Report

Search the DGRC for LP13001

Clone and Library Details

Library:LP
Tissue Source:Drosophila melanogaster larval-early pupal
Created by:Ling Hong
Date Registered:1998-06-11
Comments:Sized fractionated cDNAs were directly ligated into pOT2. Plasmid cDNA library.
Original Plate Number:130
Well:1
Vector:pOT2
Associated Gene/Transcriptl(1)G0156-RD
Protein status:LP13001.pep: gold
Sequenced Size:1393

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
l(1)G0156-RB 2010-11-11 Gleaning Pick By Joe Carlson

Clone Sequence Records

LP13001.complete Sequence

1393 bp assembled on 2010-12-09

GenBank Submission: BT125839.1

> LP13001.complete
CTACGGCGGGCGCAGACTAAAAAGACAGACTTTTTTCTATATAATATACG
GCAGGAATCAGTGCAAAAACCGATCCAACGCAATGGCTGCTAGATTCATA
CAGAAAATTCTCAATCAACTGGGTTTGATTGCAGCGCGTGATGCTCCGGC
GGTGACTGCGACGCCAGCAGTGAGCCAGGTCAACGCGACTCCCGCCGCCA
GCCGGTCCTACTCCTCCGGCACCAAGAAAGTCACCCTCATCCCTGGCGAT
GGCATCGGACCTGAGATCTCTGCGGCCGTGCAGAAAATCTTCACCGCCGC
CAATGTCCCCATCGAGTGGGAGGCCGTGGACGTGACCCCCGTCCGGGGAC
CCGACGGAAAGTTCGGCATCCCACAGGCCGCCATTGACTCGGTGAACACG
AACAAGATCGGCCTGAAGGGTCCTCTGATGACGCCCGTCGGCAAGGGCCA
TCGGTCTCTGAATCTGGCCCTGCGCAAGGAGTTCAATCTGTACGCCAACG
TGCGTCCCTGCCGCAGTCTCGAGGGCTACAAGACGCTGTACGACGATGTG
GACGTGGTCACCATCCGTGAGAACACCGAGGGCGAGTACTCCGGCATCGA
GCACGAGATCGTCGACGGCGTCGTTCAGAGCATCAAGCTGATCACCGAGG
AAGCCTCCAAGCGTGTGGCCGAGTACGCCTTCCAGTACGCCAAGAACAAC
AACCGCAAGAAGGTCACCGTGGTGCACAAGGCGAACATTATGCGCATGTC
CGATGGTCTCTTCCTGCGCTGCGTCCGCGACATGGCCCAGAAGTTCCCAG
AAATCCAGTTCGAAGAGAAGTATCTGGATACGGTGTGCCTGAACATGGTC
CAGAACCCCGGAAAATACGACGTGCTGGTCATGCCCAATCTGTACGGTGA
TATTCTGTCTGACATGTGCGCCGGTTTGGTGGGCGGCCTCGGCCTGACGC
CCTCCGGCAACATGGGCCTGAACGGTGCCCTGTTCGAGTCTGTGCACGGA
ACCGCCCCCGATATTGCCGGCAAGGACCTGGCCAATCCCACTGCCCTGTT
GCTGTCGGCGGTCATGATGCTGCGCCACATGGAGCTCAACACGTACGCCG
ATAAAATCGAGCGTGCCGCCTTCGAGACCATCAAGGAGGGCAAATACCTC
ACCGGCGATCTGGGCGGCCGTGCCAAGTGCTCCGAGTTCACGAACGAGAT
CTGTGCCAAGCTGTAGACGACGGATCACGGACCATCCGCATAAGCTGTAG
CAAGTATCGCCAACCATAACAACAACCGATGAGAACAGAGCAGAGAATTA
CGCCAGGAATATTGCGCAGAGAAGGAGGATGATGCAGTATGAACAACAGC
AATTAAACACTCGCCCCAAACCAAAAAAAAAAAAAAAAAAAAA

LP13001.complete Blast Records

Blast to d_melanogaster_OreR.fa performed 2014-11-27 16:36:15
Subject Length Description Subject Range Query Range Score Percent Strand
chrX 22417052 chrX 19407962..19408457 1372..877 2480 100 Minus
chrX 22417052 chrX 19408734..19409130 742..346 1970 99.7 Minus
chrX 22417052 chrX 19409490..19409662 347..175 865 100 Minus
chrX 22417052 chrX 19408525..19408662 879..742 690 100 Minus
chrX 22417052 chrX 19410486..19410594 109..1 545 100 Minus
chrX 22417052 chrX 19410157..19410227 180..110 355 100 Minus
chr3L 24539361 chr3L 8829918..8830070 539..691 330 81 Plus
chr3L 24539361 chr3L 8830262..8830477 865..1080 285 75.5 Plus
chr3R 27901430 chr3R 17841328..17841430 770..668 200 79.6 Minus
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 16:36:12
Subject Length Description Subject Range Query Range Score Percent Strand
l(1)G0156-RD 1134 CG12233-PD 1..1134 83..1216 5670 100 Plus
l(1)G0156-RC 1065 CG12233-PC 28..1065 179..1216 5190 100 Plus
l(1)G0156-RA 1065 CG12233-PA 28..1065 179..1216 5190 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 16:36:11
Subject Length Description Subject Range Query Range Score Percent Strand
l(1)G0156-RD 1395 CG12233-RD 24..1395 1..1372 6860 100 Plus
l(1)G0156-RC 2029 CG12233-RC 133..1326 179..1372 5970 100 Plus
l(1)G0156-RA 1332 CG12233-RA 139..1332 179..1372 5970 100 Plus
l(1)G0156-RC 2029 CG12233-RC 24..137 1..114 555 99.1 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 16:36:14
Subject Length Description Subject Range Query Range Score Percent Strand
l(1)G0156-PD 377 CG12233-PD 1..377 83..1213 1930 100 Plus
l(1)G0156-PC 354 CG12233-PC 1..354 83..1213 1787 93.9 Plus
l(1)G0156-PA 354 CG12233-PA 1..354 83..1213 1787 93.9 Plus
CG32026-PA 719 CG32026-PA 353..718 134..1213 1146 61.7 Plus
CG6439-PB 370 CG6439-PB 25..365 185..1201 726 42.9 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 16:36:08
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 19519115..19519626 1388..877 2560 100 Minus
X 23542271 X 19519903..19520299 742..346 1985 100 Minus
X 23542271 X 19520659..19520831 347..175 865 100 Minus
X 23542271 X 19519694..19519831 879..742 690 100 Minus
X 23542271 X 19521673..19521781 109..1 545 100 Minus
X 23542271 X 19521326..19521396 180..110 355 100 Minus
3L 28110227 3L 8837967..8838119 539..691 330 81 Plus
3L 28110227 3L 8838311..8838526 865..1080 285 75.5 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 23:03:57
Subject Length Description Subject Range Query Range Score Percent Strand
X 23527363 X 19527213..19527724 1388..877 2560 100 Minus
X 23527363 X 19528001..19528397 742..346 1985 100 Minus
X 23527363 X 19528757..19528929 347..175 865 100 Minus
X 23527363 X 19527792..19527929 879..742 690 100 Minus
X 23527363 X 19529771..19529879 109..1 545 100 Minus
X 23527363 X 19529424..19529494 180..110 355 100 Minus
3L 28103327 3L 8831411..8831626 865..1080 285 75.4 Plus
3L 28103327 3L 8831067..8831132 539..604 210 87.8 Plus
Blast to na_te.dros performed on 2014-11-27 16:36:10 has no hits.

LP13001.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2014-11-27 17:54:31 Download gff for LP13001.complete
Subject Subject Range Query Range Percent Splice Strand
chrX 19410486..19410594 1..109 100   Minus
chrX 19410159..19410227 110..178 100 <- Minus
chrX 19409491..19409658 179..346 100 <- Minus
chrX 19408735..19409129 347..741 99 <- Minus
chrX 19408527..19408662 742..877 100 <- Minus
chrX 19407962..19408456 878..1372 100 <- Minus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2010-12-10 09:34:28 Download gff for LP13001.complete
Subject Subject Range Query Range Percent Splice Strand
l(1)G0156-RB 1..1134 83..1216 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-03 20:35:14 Download gff for LP13001.complete
Subject Subject Range Query Range Percent Splice Strand
l(1)G0156-RD 1..1134 83..1216 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 17:54:31 Download gff for LP13001.complete
Subject Subject Range Query Range Percent Splice Strand
l(1)G0156-RD 1..1134 83..1216 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2010-12-10 09:34:28 Download gff for LP13001.complete
Subject Subject Range Query Range Percent Splice Strand
l(1)G0156-RB 30..1401 1..1372 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-03 20:35:14 Download gff for LP13001.complete
Subject Subject Range Query Range Percent Splice Strand
l(1)G0156-RD 24..1395 1..1372 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 17:54:31 Download gff for LP13001.complete
Subject Subject Range Query Range Percent Splice Strand
l(1)G0156-RD 24..1395 1..1372 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 17:54:31 Download gff for LP13001.complete
Subject Subject Range Query Range Percent Splice Strand
X 19521673..19521781 1..109 100   Minus
X 19521328..19521396 110..178 100 <- Minus
X 19520660..19520827 179..346 100 <- Minus
X 19519904..19520298 347..741 100 <- Minus
X 19519696..19519831 742..877 100 <- Minus
X 19519131..19519625 878..1372 100 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-03 20:35:14 Download gff for LP13001.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 19415706..19415814 1..109 100   Minus
arm_X 19415361..19415429 110..178 100 <- Minus
arm_X 19414693..19414860 179..346 100 <- Minus
arm_X 19413937..19414331 347..741 100 <- Minus
arm_X 19413729..19413864 742..877 100 <- Minus
arm_X 19413164..19413658 878..1372 100 <- Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 19:52:44 Download gff for LP13001.complete
Subject Subject Range Query Range Percent Splice Strand
X 19529771..19529879 1..109 100   Minus
X 19529426..19529494 110..178 100 <- Minus
X 19528758..19528925 179..346 100 <- Minus
X 19528002..19528396 347..741 100 <- Minus
X 19527794..19527929 742..877 100 <- Minus
X 19527229..19527723 878..1372 100 <- Minus

LP13001.hyp Sequence

Translation from 0 to 1215

> LP13001.hyp
YGGRRLKRQTFFYIIYGRNQCKNRSNAMAARFIQKILNQLGLIAARDAPA
VTATPAVSQVNATPAASRSYSSGTKKVTLIPGDGIGPEISAAVQKIFTAA
NVPIEWEAVDVTPVRGPDGKFGIPQAAIDSVNTNKIGLKGPLMTPVGKGH
RSLNLALRKEFNLYANVRPCRSLEGYKTLYDDVDVVTIRENTEGEYSGIE
HEIVDGVVQSIKLITEEASKRVAEYAFQYAKNNNRKKVTVVHKANIMRMS
DGLFLRCVRDMAQKFPEIQFEEKYLDTVCLNMVQNPGKYDVLVMPNLYGD
ILSDMCAGLVGGLGLTPSGNMGLNGALFESVHGTAPDIAGKDLANPTALL
LSAVMMLRHMELNTYADKIERAAFETIKEGKYLTGDLGGRAKCSEFTNEI
CAKL*

LP13001.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 17:32:34
Subject Length Description Subject Range Query Range Score Percent Strand
l(1)G0156-PD 377 CG12233-PD 1..377 28..404 1930 100 Plus
l(1)G0156-PC 354 CG12233-PC 1..354 28..404 1787 93.9 Plus
l(1)G0156-PA 354 CG12233-PA 1..354 28..404 1787 93.9 Plus
CG32026-PA 719 CG32026-PA 353..718 45..404 1146 61.7 Plus
CG6439-PB 370 CG6439-PB 25..365 62..400 726 42.9 Plus

LP13001.pep Sequence

Translation from 82 to 1215

> LP13001.pep
MAARFIQKILNQLGLIAARDAPAVTATPAVSQVNATPAASRSYSSGTKKV
TLIPGDGIGPEISAAVQKIFTAANVPIEWEAVDVTPVRGPDGKFGIPQAA
IDSVNTNKIGLKGPLMTPVGKGHRSLNLALRKEFNLYANVRPCRSLEGYK
TLYDDVDVVTIRENTEGEYSGIEHEIVDGVVQSIKLITEEASKRVAEYAF
QYAKNNNRKKVTVVHKANIMRMSDGLFLRCVRDMAQKFPEIQFEEKYLDT
VCLNMVQNPGKYDVLVMPNLYGDILSDMCAGLVGGLGLTPSGNMGLNGAL
FESVHGTAPDIAGKDLANPTALLLSAVMMLRHMELNTYADKIERAAFETI
KEGKYLTGDLGGRAKCSEFTNEICAKL*

LP13001.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2014-11-28 09:25:59
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF20487-PA 377 GF20487-PA 1..377 1..377 1889 96 Plus
Dana\GF16953-PA 371 GF16953-PA 17..366 29..373 706 42.4 Plus
Dana\GF16768-PA 402 GF16768-PA 1..386 1..377 695 38.5 Plus
Dana\GF13612-PA 412 GF13612-PA 88..407 50..377 691 42.2 Plus
Dana\GF22695-PA 255 GF22695-PA 4..239 143..377 537 43.2 Plus
Blast to dere-all-translation-r1.3.fasta performed 2014-11-28 09:26:00
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG18052-PA 377 GG18052-PA 1..377 1..377 1995 99.2 Plus
Dere\GG12546-PA 370 GG12546-PA 22..365 32..373 712 42.6 Plus
Dere\GG11421-PA 402 GG11421-PA 1..386 1..377 690 38.2 Plus
Dere\GG22965-PA 395 GG22965-PA 54..388 34..374 685 40.4 Plus
Dere\GG22281-PA 378 GG22281-PA 42..357 33..363 223 22.8 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2014-11-28 09:26:01
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH17867-PA 354 GH17867-PA 1..354 1..377 1806 90.5 Plus
Dgri\GH16376-PA 361 GH16376-PA 11..348 40..377 1510 81.4 Plus
Dgri\GH20895-PA 386 GH20895-PA 61..378 48..374 757 45.3 Plus
Dgri\GH19869-PA 370 GH19869-PA 17..369 29..377 737 43 Plus
Dgri\GH18988-PA 402 GH18988-PA 1..386 1..377 686 38.7 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 09:25:58
Subject Length Description Subject Range Query Range Score Percent Strand
l(1)G0156-PD 377 CG12233-PD 1..377 1..377 1930 100 Plus
l(1)G0156-PC 354 CG12233-PC 1..354 1..377 1787 93.9 Plus
l(1)G0156-PA 354 CG12233-PA 1..354 1..377 1787 93.9 Plus
CG32026-PA 719 CG32026-PA 353..718 18..377 1146 61.7 Plus
CG6439-PB 370 CG6439-PB 25..365 35..373 726 42.9 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2014-11-28 09:26:03
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI16435-PA 377 GI16435-PA 1..377 1..377 1862 91.5 Plus
Dmoj\GI11568-PA 354 GI11568-PA 11..354 34..377 1463 77 Plus
Dmoj\GI18905-PA 399 GI18905-PA 78..391 50..374 749 46.3 Plus
Dmoj\GI22037-PA 370 GI22037-PA 22..369 32..377 734 42.7 Plus
Dmoj\GI22415-PA 402 GI22415-PA 1..386 1..377 679 39.1 Plus
Blast to dper-all-translation-r1.3.fasta performed 2014-11-28 09:26:04
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL14780-PA 351 GL14780-PA 1..351 1..377 1746 89.1 Plus
Dper\GL23725-PA 378 GL23725-PA 40..377 42..377 742 45.1 Plus
Dper\GL20101-PA 411 GL20101-PA 87..405 48..374 698 42.4 Plus
Dper\GL21529-PA 402 GL21529-PA 1..386 1..377 689 38.9 Plus
Dper\GL11354-PA 395 GL11354-PA 25..386 20..367 287 24.3 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2014-11-28 09:26:06
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA11495-PA 373 GA11495-PA 1..373 1..377 1907 95 Plus
Dpse\GA16620-PA 332 GA16620-PA 1..331 53..377 1137 63.4 Plus
Dpse\GA19594-PA 378 GA19594-PA 40..377 42..377 742 45.1 Plus
Dpse\GA17474-PA 411 GA17474-PA 87..405 48..374 690 42.1 Plus
Dpse\GA18606-PA 402 GA18606-PA 1..386 1..377 689 38.9 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2014-11-28 09:26:07
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM22739-PA 377 GM22739-PA 1..377 1..377 2007 99.7 Plus
Dsec\GM23677-PA 370 GM23677-PA 22..365 32..373 713 42.6 Plus
Dsec\GM11859-PA 389 GM11859-PA 54..386 34..374 703 41.8 Plus
Dsec\GM10262-PA 321 GM10262-PA 4..314 66..377 616 40.3 Plus
Dsec\GM20069-PA 378 GM20069-PA 42..357 33..363 238 24.2 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2014-11-28 09:26:08
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD15579-PA 377 GD15579-PA 1..377 1..377 2010 100 Plus
Dsim\GD14133-PA 722 GD14133-PA 388..721 50..377 1173 65.6 Plus
Dsim\GD18486-PA 370 GD18486-PA 22..365 32..373 713 42.6 Plus
Dsim\GD21232-PA 392 GD21232-PA 1..385 1..377 675 37.9 Plus
Dsim\GD11857-PA 388 GD11857-PA 54..385 34..374 640 39.5 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2014-11-28 09:26:09
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ11248-PA 367 GJ11248-PA 14..354 37..377 1577 84.8 Plus
Dvir\GJ15838-PA 258 GJ15838-PA 1..250 1..255 1036 79.2 Plus
Dvir\GJ20729-PA 426 GJ20729-PA 100..418 48..374 777 46.3 Plus
Dvir\GJ24090-PA 371 GJ24090-PA 33..370 42..377 726 43.1 Plus
Dvir\GJ10975-PA 402 GJ10975-PA 1..386 1..377 671 38.2 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2014-11-28 09:26:11
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK25509-PA 379 GK25509-PA 1..379 1..377 1869 94.2 Plus
Dwil\GK13007-PA 370 GK13007-PA 32..369 42..377 729 43 Plus
Dwil\GK12856-PA 402 GK12856-PA 1..386 1..377 687 39.1 Plus
Dwil\GK19462-PA 390 GK19462-PA 7..294 68..361 681 47.5 Plus
Dwil\GK19318-PA 388 GK19318-PA 49..363 33..362 285 24.4 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2014-11-28 09:26:12
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE17383-PA 268 GE17383-PA 112..268 221..377 852 100 Plus
Dyak\GE24066-PA 370 GE24066-PA 22..365 32..373 713 42.6 Plus
Dyak\GE23616-PA 402 GE23616-PA 1..386 1..377 685 37.9 Plus
Dyak\GE14404-PA 393 GE14404-PA 52..386 34..374 682 40.7 Plus
Dyak\GE17383-PA 268 GE17383-PA 1..88 1..88 375 98.9 Plus
Dyak\GE14076-PA 378 GE14076-PA 30..357 21..363 237 23.5 Plus