Clone LP14411 Report

Search the DGRC for LP14411

Clone and Library Details

Library:LP
Tissue Source:Drosophila melanogaster larval-early pupal
Created by:Ling Hong
Date Registered:1998-06-11
Comments:Sized fractionated cDNAs were directly ligated into pOT2. Plasmid cDNA library.
Original Plate Number:144
Well:11
Vector:pOT2
Associated Gene/TranscriptCG11378-RA
Protein status:LP14411.pep: gold
Sequenced Size:1722

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG11378 2010-06-24 Manual selection by Sue Celniker

Clone Sequence Records

LP14411.complete Sequence

1722 bp assembled on 2011-01-10

GenBank Submission: BT125894.1

> LP14411.complete
TTCTGGAGCTCGTTTCCACGCTACCTTCTTCATGATTGGTACCGGAGAGG
GATCGGCCCACCACTTGACGAGAAATCATCACTCGCGTTTATCTAGGATT
TGTAATTGCCGGAAAAGAATCAGACCCTGGAAAAACTTTGTACTTTGGCC
GCAGTGGCCGAAGTGTGAATGATGTCACTGTCGTTTGATTGAACAAAGCC
GAAACGCAATCGCACAGTGAGTCAAAGTGCGCACTCACAAGATGAAATAA
TGAGCTTTAGAAATACATTAAATGTTTTAACCGTTGTCAGTGATAATCAT
TGATATCTGTATCCTATTTCTGCATTATTCGGTTATATATTTAGAAAGAA
TTATTATCAGGAAAGACAAAAAGACGAAGTTTACTAGCGATAAGATTGTC
GAAATCGGGTTTGGAATGGATTACGACTGAGCCCACTGTGCGGCGTCATC
GACGCTTGGTTTCGCTGTGCCATGTCGCTTCGTGCCCTGTAGAAGTCGTT
CTCATTCAGTCACGGGCAGCACTTAACCACAGTCGGATCTACAGACGCAC
ACCACCGCCACCAACACCACCACATCGACCTATCCATCCATCGCCAGCAT
GAACAAGTACGGGATGGTCGGCGTCTGCCTACTGGCTGCTCTGGGCGCTC
TGCTCCTGGAGGTCACTGCCTCTCCTTCGTCCGCCGCCTCGTCTAAGGTG
GATCCTAGCCAACTTGGCGGACTTTCAGCTCAGTTCTTGCCACCCGAGTA
CCGCAACACGAACGTTAGCATCGAGGATATAAAAAGAATATATCGTGAAA
AATGCAAGAAGGTAAATGGAGCGGACAACGCAACCTTCTACGAAGAAATC
GAGCGGGCGGCAGCCAAGATGAGCACCTGCATCAGCGGGGTGGTCAATCT
GACGGCTCTGCAGGAGGAGATGGATGTGGCGAGGCCGAACGGCGACTTGG
ACACCGTGTTTAGCAAATACTGTCTCAAGGCACCGGAGGCAGAGGCCTGC
GTCAAGGAGTTCAACGACAAGGCGCAGCATTGCTTGACCCCCGAGGAGAA
GCGCCACCAGGAGACGGTTACCCGAATTGGAGCGTCCGTTTTGGGATTCG
CCTGTTCGCGTGGCGGCGATCAGATTGCCCTCTTCATTGCCGAGCAGGGA
CCCGAGTGCCTGGAGGCCAACAAGGAAGCCATTAGCAATTGCCTCAATCA
ATCCTTTCATCAGTACATTCCCAAGGATGGCCAAGTTCCGGACCTGATGA
GCCGCCCAGAGCTCCTTTTCTCACCCACCCACTGCGTGGACCTGCAGCGC
TTCGAGGCCTGTGTCATCCATCATTTGGAGCAGTGCACGCAGATCACCAC
CGCTAATATCGTTCAGTCCGTCTTCCGTTTCGTGAAGAACGAGACCGACT
GCCAGGCTTGGATGCAGGCACGTGCGAACGAGAAGCCCATTCTGATGGCC
GCCTCCAGCAACAACACAGCCCCTGGACTCGCCTACTCCCTGGCCGGCAC
TCTTTTGGGCGCCACAATACTCCTGATACTCCCCTGAATGAAAAGCATAG
TGAGGTAATCTTTTTTTTTTTTCGATAACAAACGCCTGTGTATTGCGGAC
ATTTTTTTTGTTTGTGTGTGTATAGTGGGCACCGAGTATCGGTGCCGTAG
TATTTAATGTCTCCTAAGGAATTGCCAATAATAAACGTGATTACGATGAA
AAAAAAAAAAAAAAAAAAAAAA

LP14411.complete Blast Records

Blast to d_melanogaster_OreR.fa performed 2014-11-27 16:50:29
Subject Length Description Subject Range Query Range Score Percent Strand
chrX 22417052 chrX 1065779..1066704 773..1698 4615 99.9 Plus
chrX 22417052 chrX 1065232..1065662 343..773 2140 99.8 Plus
chrX 22417052 chrX 1064792..1065135 1..344 1720 100 Plus
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 16:50:26
Subject Length Description Subject Range Query Range Score Percent Strand
CG11378-RC 939 CG11378-PC 1..939 599..1537 4695 100 Plus
CG11378-RB 939 CG11378-PB 1..939 599..1537 4695 100 Plus
CG11378-RA 939 CG11378-PA 1..939 599..1537 4695 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 16:50:24
Subject Length Description Subject Range Query Range Score Percent Strand
CG11378-RB 1698 CG11378-RB 1..1698 1..1698 8490 100 Plus
CG11378-RC 2256 CG11378-RC 1..1199 500..1698 5995 100 Plus
CG11378-RA 1199 CG11378-RA 1..1199 500..1698 5995 100 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 16:50:28
Subject Length Description Subject Range Query Range Score Percent Strand
CG11378-PC 312 CG11378-PC 1..297 599..1489 1493 100 Plus
CG11378-PB 312 CG11378-PB 1..297 599..1489 1493 100 Plus
CG11378-PA 312 CG11378-PA 1..297 599..1489 1493 100 Plus
CG14629-PA 319 CG14629-PA 25..272 689..1405 560 44 Plus
CG9917-PB 301 CG9917-PB 36..273 737..1462 505 41 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 16:50:22
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 1171815..1172742 773..1700 4640 100 Plus
X 23542271 X 1171268..1171698 343..773 2155 100 Plus
X 23542271 X 1170828..1171171 1..344 1720 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 23:05:05
Subject Length Description Subject Range Query Range Score Percent Strand
X 23527363 X 1179913..1180840 773..1700 4640 100 Plus
X 23527363 X 1179366..1179796 343..773 2155 100 Plus
X 23527363 X 1178926..1179269 1..344 1720 100 Plus
Blast to na_te.dros performed on 2014-11-27 16:50:23 has no hits.

LP14411.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2014-11-27 17:59:12 Download gff for LP14411.complete
Subject Subject Range Query Range Percent Splice Strand
chrX 1065780..1066704 774..1698 99   Plus
chrX 1065234..1065662 345..773 99 -> Plus
chrX 1064792..1065135 1..344 100 -> Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-01-11 10:26:12 Download gff for LP14411.complete
Subject Subject Range Query Range Percent Splice Strand
CG11378-RA 1..939 599..1537 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-03 20:40:04 Download gff for LP14411.complete
Subject Subject Range Query Range Percent Splice Strand
CG11378-RA 1..939 599..1537 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 17:59:12 Download gff for LP14411.complete
Subject Subject Range Query Range Percent Splice Strand
CG11378-RA 1..939 599..1537 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-01-11 10:26:12 Download gff for LP14411.complete
Subject Subject Range Query Range Percent Splice Strand
CG11378-RA 1..1195 504..1698 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-03 20:40:04 Download gff for LP14411.complete
Subject Subject Range Query Range Percent Splice Strand
CG11378-RB 1..1698 1..1698 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 17:59:12 Download gff for LP14411.complete
Subject Subject Range Query Range Percent Splice Strand
CG11378-RB 1..1698 1..1698 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 17:59:12 Download gff for LP14411.complete
Subject Subject Range Query Range Percent Splice Strand
X 1171816..1172740 774..1698 100   Plus
X 1171270..1171698 345..773 100 -> Plus
X 1170828..1171171 1..344 100 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-03 20:40:04 Download gff for LP14411.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 1065849..1066773 774..1698 100   Plus
arm_X 1065303..1065731 345..773 100 -> Plus
arm_X 1064861..1065204 1..344 100 -> Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 19:54:46 Download gff for LP14411.complete
Subject Subject Range Query Range Percent Splice Strand
X 1179914..1180838 774..1698 100   Plus
X 1179368..1179796 345..773 100 -> Plus
X 1178926..1179269 1..344 100 -> Plus

LP14411.pep Sequence

Translation from 598 to 1536

> LP14411.pep
MNKYGMVGVCLLAALGALLLEVTASPSSAASSKVDPSQLGGLSAQFLPPE
YRNTNVSIEDIKRIYREKCKKVNGADNATFYEEIERAAAKMSTCISGVVN
LTALQEEMDVARPNGDLDTVFSKYCLKAPEAEACVKEFNDKAQHCLTPEE
KRHQETVTRIGASVLGFACSRGGDQIALFIAEQGPECLEANKEAISNCLN
QSFHQYIPKDGQVPDLMSRPELLFSPTHCVDLQRFEACVIHHLEQCTQIT
TANIVQSVFRFVKNETDCQAWMQARANEKPILMAASSNNTAPGLAYSLAG
TLLGATILLILP*

LP14411.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2014-11-28 12:52:27
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF22134-PA 321 GF22134-PA 1..318 1..311 1311 76.1 Plus
Dana\GF22129-PA 323 GF22129-PA 1..280 1..270 581 40.4 Plus
Dana\GF19082-PA 323 GF19082-PA 24..257 44..274 404 37.7 Plus
Dana\GF22135-PA 239 GF22135-PA 26..212 67..270 291 38.1 Plus
Blast to dere-all-translation-r1.3.fasta performed 2014-11-28 12:52:28
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG12830-PA 309 GG12830-PA 1..309 1..312 1472 91 Plus
Dere\GG12829-PA 322 GG12829-PA 20..276 13..270 581 43.9 Plus
Dere\GG19331-PA 302 GG19331-PA 10..274 14..288 498 38.6 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2014-11-28 12:52:29
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH11997-PA 312 GH11997-PA 1..289 1..293 1109 71.3 Plus
Dgri\GH11994-PA 322 GH11994-PA 15..279 6..269 550 39.3 Plus
Dgri\GH12279-PA 301 GH12279-PA 43..294 54..303 491 39.9 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 12:52:26
Subject Length Description Subject Range Query Range Score Percent Strand
CG11378-PC 312 CG11378-PC 1..312 1..312 1614 100 Plus
CG11378-PB 312 CG11378-PB 1..312 1..312 1614 100 Plus
CG11378-PA 312 CG11378-PA 1..312 1..312 1614 100 Plus
CG14629-PA 319 CG14629-PA 17..315 13..308 571 40.2 Plus
CG9917-PB 301 CG9917-PB 9..273 14..288 506 38.6 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2014-11-28 12:52:30
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI15624-PA 312 GI15624-PA 1..289 1..293 1137 74.1 Plus
Dmoj\GI15617-PA 322 GI15617-PA 37..278 30..269 561 43.9 Plus
Dmoj\GI10977-PA 300 GI10977-PA 27..264 39..273 454 40.3 Plus
Blast to dper-all-translation-r1.3.fasta performed 2014-11-28 12:52:31
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL14224-PA 323 GL14224-PA 31..289 33..279 607 45.6 Plus
Dper\GL14229-PA 146 GL14229-PA 1..142 1..141 585 75.4 Plus
Dper\GL21344-PA 192 GL21344-PA 38..187 47..195 355 46.7 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2014-11-28 12:52:32
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA10959-PA 319 GA10959-PA 1..310 1..308 1311 76.8 Plus
Dpse\GA13127-PA 323 GA13127-PA 31..289 33..279 607 45.6 Plus
Dpse\GA22121-PA 303 GA22121-PA 38..280 47..294 529 42.8 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2014-11-28 12:52:33
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM19115-PA 312 GM19115-PA 1..312 1..312 1541 97.8 Plus
Dsec\GM19113-PA 317 GM19113-PA 17..313 13..308 583 39.5 Plus
Dsec\GM13409-PA 301 GM13409-PA 9..268 14..283 491 38.2 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2014-11-28 12:52:34
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD16544-PA 312 GD16544-PA 1..312 1..312 1644 98.1 Plus
Dsim\GD16543-PA 317 GD16543-PA 17..313 13..308 583 39.5 Plus
Dsim\GD15756-PA 301 GD15756-PA 36..268 47..283 480 40.2 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2014-11-28 12:52:36
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ16336-PA 314 GJ16336-PA 1..307 1..311 1142 72 Plus
Dvir\GJ15221-PA 312 GJ15221-PA 7..305 8..311 599 40.6 Plus
Dvir\GJ19442-PA 300 GJ19442-PA 36..265 47..273 504 41.2 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2014-11-28 12:52:37
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK16360-PA 312 GK16360-PA 1..310 1..308 1244 72.8 Plus
Dwil\GK16357-PA 317 GK16357-PA 12..293 9..279 620 42.6 Plus
Dwil\GK10066-PA 249 GK10066-PA 23..246 47..268 488 41.9 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2014-11-28 12:52:38
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE16663-PA 307 GE16663-PA 1..307 1..312 1465 91.1 Plus
Dyak\GE16661-PA 322 GE16661-PA 1..317 1..308 597 39.4 Plus
Dyak\GE15978-PA 302 GE15978-PA 9..268 14..283 483 38.2 Plus

LP14411.hyp Sequence

Translation from 598 to 1536

> LP14411.hyp
MNKYGMVGVCLLAALGALLLEVTASPSSAASSKVDPSQLGGLSAQFLPPE
YRNTNVSIEDIKRIYREKCKKVNGADNATFYEEIERAAAKMSTCISGVVN
LTALQEEMDVARPNGDLDTVFSKYCLKAPEAEACVKEFNDKAQHCLTPEE
KRHQETVTRIGASVLGFACSRGGDQIALFIAEQGPECLEANKEAISNCLN
QSFHQYIPKDGQVPDLMSRPELLFSPTHCVDLQRFEACVIHHLEQCTQIT
TANIVQSVFRFVKNETDCQAWMQARANEKPILMAASSNNTAPGLAYSLAG
TLLGATILLILP*

LP14411.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 17:06:32
Subject Length Description Subject Range Query Range Score Percent Strand
CG11378-PC 312 CG11378-PC 1..312 1..312 1614 100 Plus
CG11378-PB 312 CG11378-PB 1..312 1..312 1614 100 Plus
CG11378-PA 312 CG11378-PA 1..312 1..312 1614 100 Plus
CG14629-PA 319 CG14629-PA 17..315 13..308 571 40.2 Plus
CG9917-PB 301 CG9917-PB 9..273 14..288 506 38.6 Plus