Clone LP15878 Report

Search the DGRC for LP15878

Clone and Library Details

Library:LP
Tissue Source:Drosophila melanogaster larval-early pupal
Created by:Ling Hong
Date Registered:1998-06-11
Comments:Sized fractionated cDNAs were directly ligated into pOT2. Plasmid cDNA library.
Original Plate Number:158
Well:78
Vector:pOT2
Associated Gene/TranscriptCG14669-RA
Protein status:LP15878.pep: Inserted from web
Sequenced Size:3402

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG14669 2005-03-03 Blastp of sequenced clone
CG14669 2008-04-29 Release 5.5 accounting
CG14669 2008-08-15 Release 5.9 accounting
CG14669 2008-12-18 5.12 accounting

Clone Sequence Records

LP15878.complete Sequence

3402 bp (3402 high quality bases) assembled on 2005-03-03

GenBank Submission: BT021353.1

> LP15878.complete
AGCAGCATCCGCCAGCAGATTCGCAAGCCAGTTCGCTGCCAGAAGCCAAA
ACCCAAGGCAAAGCCAGCCGAACCGGGCCAATTCTAGGGGAACGCGTGTG
TGTGAAGAGCGGCACCACAATAAGAAAATCATAATGATGATGGATTAACT
GATCCCAGTTGTTGTTCATGTTGTGCGAGTGAGACAGCGCGAGTGTGGAA
GGAGCACCGGAAGTGGCAGCAGTAGCGGCATTAGCAGCAGCAACAGCACC
GCAGCAACATTGCAGCAGCAGCAGCAGCAGCAACAGCAAAGGCGAAATCA
GCAAATACAAACGAATCATCTAGCACTACCACAAAACGCAATATAATTTC
AAACCTGCTGGCTTCGCATCCACCCAAAACGTGTCCTTCCATCCCAAAAG
ATCCAATAAATCCGGCAAGCTGGCGTCGTTTAAGCAGAAGAATAACAATA
ACACCATTAGCAATTACAACAACAATATAATGTGGAGTAGTACTATATCG
CCAACCAACTCTAAGAAACTGTTGATCGGAAGCACACGAAGCGTTGATTA
TGTCGGTGATAGTGCGAGGACAGCAGCAGGCAATATCAAAACAGGAGCAG
CAGCAGCCGCAGGAGCCAAAGGATCAAAATCCAAAGCCACAGCCACAGCC
CCCACAACCAAGATCTCAATCGAAATGGAGCTCCACATACAGAACAAGTG
CATCTCGGCATAGCGCATCACTCTGGAGGGTGGTGCGGAGCCGCCATGGC
TGCAGGGCCCCCTTAAAGCCGCGTTTTTGGGGGCTACTGGGGTCGGCAAA
ACAAGCATACTACAGCAATTTTTCTACCATGACTTTCCCAGGACTCATCA
GACGACAACTCATCGCAAGATCTACAAAAACTGTCTGGTCTGCGACACCT
GCATACGTGAGCTGATGGTACTGGACGTTCCTCCCCAGAAGCGATTTCCG
GCTGACAACTTCGCCGAGTGGAACAACGGACATCCGCTGGGGCTGCGAAC
GGTGCACGCCTATGTCTTGGTCTACGACATGGGCAACTTGGAGACCTTTC
AATACTGCCGCTCGATGAGAGATCAGATCTTGGACAGTTTCAGTCATCGT
GATTTTAGCATAATTGTGGTCGGCAATAAATTTGACAATGTGACTGAGGC
GCAGGCCAACTCGCAGGAGCTCAAGGACATTTCCACGCTGGTGCGCAAAC
ATTGGCGCTGCGGCTACGTCGAGTGCTCGGCGCAATATAACTACAAAATC
GGAGACGTTTTCCGCGAGCTGATGGGCTGCACCAGCGCTGTAGGAGGAGG
CGGCGCCGGCGGAGGTGGAGGCGTGGCCGGGGTCGGTGGCCTGGTTGGCA
CTGAGTACTCACAATCAACTAGGAATAAAGGACGCTGTACAATACTGTAG
CAAGAGTTGCATAAGTTTTATAAGCAAACGCGCTGATCTGGCGCATTACA
TCCGAGTGAATTCATCGCAAGACGGTGGCTGCAGCTGGGACACGGTGGCG
TATACGCAATCTCCAGGGAGGAAGCACAAAGACGACATTGTTGCCCCTTG
CCAACGCTTGCCCTCTGATGCATATTTTACCATATATTTTAGTGGCCACA
CTCCGCACATCTTCTCCTTTGTTTGCCATTATTACAACATTTTGTGTTCC
CGGCTGTTTCCATGGACGCTTTTGCTCTGCTTATTTAAATGGCAGTGGCA
ATGGCAATGGCCATGGCCCCGCCGCACACAGGACACGTTTGGCCAGCACC
CAGATCCCGATCCTGACGACGGCTTTTGTGCGTCCGCATTTGCAATTCAA
TTCATATTTCGCTGGCAGGAAGTGCAATGGCCATGAATATGCAGAGATAT
CCGCAAAGTGCAGCCACAATGGCCGGCGAAAGTTCCCTTTGCGACCATCA
TCATTATCGTTGTGGCTATTATTTGTGTCGTGGATCGTAAATAGGCAATT
AATCCCACCATAATTTACAATACGTTTTATGTACGAACGAATAACCTTGT
TATCAAACAAACTAAAGTCGGTTAGGAACTAAAGTAAAGAACTAAGCTAT
ACACACATATACTTAAACATATATGTATACATTAACGTTGTGATCATTTC
AAGAATTAGTTCTTAAGGCACTCCGACCCAGAACGTCGGCCAATGTCAAG
TGAAGTCAAGTCAAGTCAAGTCAAGTATCCGTATCCGTATCCGGAACTGG
AATACCAGAAATACTTAGCTATAGGACACAGTACGAGTAAGAGCAATTTA
ATAAATAGTCGTAAGTGTTTGGAGAGCGGTCGAAGGCGGTAAAATCAAAC
AGTTACAATCATGCCATGAAAATCCTCAACAGGCCAGCTCCATAATATCC
ATAAATATTCGCTCCGCAATTTGCTTGAAATGAATAACCACCCGAATCTG
GCATCAAGTTATTGCAATATAACCTAAACCACAGATCAATCATTGACTTT
ACCCATGTTTCGCCATCGAGGAGCCGTGATCCAGAAGCCTTAAGAACCCA
GAAGCAAATGATGCATAGAACACCTTAGTGTAAAGTAAGATAACAACTTG
ATCGAAGCGCACAAAAAACGAGCATTGTGTTACCATCGCAAACTCGAAAT
TGTCAGAGCCCAGATTGAAGAAAGGTCGAAGGCCACATCTGCGTACAGTA
GTATCGAAATCGCCTATCTATTAGGTAGGTGTGGTTCTATATATCCGTAC
TGGCGATCGTCAAGTTAATTAGGTTCTGAGCAGATCTACGAAACACGTAC
ATACCATTCTGATCTCTTTCTTTACCTCAAGAAGACAACTTAAACTACTC
AAAAGAAAAGCAATCAAGGCTGACTTTGTACATAGGGATTTCAATGAAAG
AACTTGGCAAAAAGCTACGGGAACCGACTTTTACAGCAATACATATAAAT
AAGCTCTAACTGATATTCAAGATAGATACATAACTGGGCGCACTGCCACA
ATGGTTCCACTCCCAGTTGAGTGCTCGGCTAGGATTCTAGGAGTAGCTGA
GCCAGCAAGTATCTTGAAACAATTCGACGGCATTATTTTAAGGTTAACCA
ATGCAAATCGATAATAATACGAGGGTACTAGCCCATTATTGTTATACATA
TTATTATTAATATAGATTTCGCGGCTTTAAGATGGGTGGGGGTAAGGTTT
GAAAGTTTTTTGATGGAGAATATATACAAAAAGGGGCCTGTCAGGCAGTT
GTTTGCCACTCTTACAGAGAGTTATTTGAAAAAAGCCCTTTTTCAGATTT
TTAATTTCGCTTTAAGGTGAAAGATGTTTCCTTTCTTAAATTAAGAAAGA
ATTTCAAAAACGTTGCTGTAGCTTTTTAGTTTCGCTGCGATTAACTTTAG
AATTATACAGAATATTTTGAAATATTGAAAAACGAAAAAAAAAAAAAAAA
AA

LP15878.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 17:53:58
Subject Length Description Subject Range Query Range Score Percent Strand
CG14669-RA 3384 CG14669-RA 1..3384 1..3384 16920 100 Plus
Blast to d_melanogaster_OreR.fa performed 2014-11-26 19:54:41
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 1281110..1283259 1235..3384 10750 100 Plus
chr3R 27901430 chr3R 1262791..1263308 298..815 2590 100 Plus
chr3R 27901430 chr3R 1242361..1242557 105..301 985 100 Plus
chr3R 27901430 chr3R 1267782..1267907 813..938 630 100 Plus
chr3R 27901430 chr3R 1280279..1280396 935..1052 590 100 Plus
chr3R 27901430 chr3R 1280468..1280582 1053..1167 575 100 Plus
chr3R 27901430 chr3R 1240212..1240318 1..107 535 100 Plus
chr3R 27901430 chr3R 1280957..1281028 1163..1234 360 100 Plus
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 19:54:36
Subject Length Description Subject Range Query Range Score Percent Strand
CG14669-RB 921 CG14669-PB 1..921 480..1400 4605 100 Plus
CG14669-RA 921 CG14669-PA 1..921 480..1400 4605 100 Plus
CG14669-RC 579 CG14669-PC 1..459 480..938 2295 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 19:57:11 has no hits.
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 19:54:34
Subject Length Description Subject Range Query Range Score Percent Strand
CG14669-RB 4442 CG14669-RB 369..3648 105..3384 16400 100 Plus
CG14669-RD 3648 CG14669-RD 369..3648 105..3384 16400 100 Plus
CG14669-RA 3648 CG14669-RA 369..3648 105..3384 16400 100 Plus
CG14669-RB 4442 CG14669-RB 27..133 1..107 535 100 Plus
CG14669-RD 3648 CG14669-RD 27..133 1..107 535 100 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-26 19:54:39
Subject Length Description Subject Range Query Range Score Percent Strand
CG14669-PB 306 CG14669-PB 1..306 480..1397 1285 99.7 Plus
CG14669-PA 306 CG14669-PA 1..306 480..1397 1285 99.7 Plus
CG14669-PC 192 CG14669-PC 1..153 480..938 592 99.3 Plus
CG13375-PC 277 CG13375-PC 20..181 765..1274 209 31.6 Plus
CG13375-PB 306 CG13375-PB 49..210 765..1274 209 31.6 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 19:54:31
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 5455451..5457618 1235..3402 10780 99.8 Plus
3R 32079331 3R 5437132..5437649 298..815 2590 100 Plus
3R 32079331 3R 5416702..5416898 105..301 985 100 Plus
3R 32079331 3R 5442123..5442248 813..938 630 100 Plus
3R 32079331 3R 5454620..5454737 935..1052 590 100 Plus
3R 32079331 3R 5454809..5454923 1053..1167 575 100 Plus
3R 32079331 3R 5414553..5414659 1..107 535 100 Plus
3R 32079331 3R 5455298..5455369 1163..1234 360 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:42:54
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 5196282..5198449 1235..3402 10780 99.8 Plus
3R 31820162 3R 5177963..5178480 298..815 2590 100 Plus
3R 31820162 3R 5157533..5157729 105..301 985 100 Plus
3R 31820162 3R 5182954..5183079 813..938 630 100 Plus
3R 31820162 3R 5195451..5195568 935..1052 590 100 Plus
3R 31820162 3R 5195640..5195754 1053..1167 575 100 Plus
3R 31820162 3R 5155384..5155490 1..107 535 100 Plus
3R 31820162 3R 5196129..5196200 1163..1234 360 100 Plus
Blast to na_te.dros performed 2014-11-26 19:54:33
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6798..6919 200..322 261 70.2 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2324..2412 570..658 183 70 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6808..6954 570..723 148 61.5 Plus
HMS-Beagle 7062 HMS-Beagle Beagle 7062bp 1161..1246 3032..3119 128 65.2 Plus
roo 9092 roo DM_ROO 9092bp 1059..1150 572..660 127 65.6 Plus

LP15878.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2014-11-26 22:01:58 Download gff for LP15878.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 1281110..1283259 1235..3384 98   Plus
chr3R 1280961..1281028 1167..1234 100 -> Plus
chr3R 1280468..1280581 1053..1166 100 -> Plus
chr3R 1280283..1280396 939..1052 100 -> Plus
chr3R 1267785..1267907 816..938 100 -> Plus
chr3R 1262791..1263308 298..815 100 -> Plus
chr3R 1242364..1242471 108..215 100 == Plus
chr3R 1240212..1240318 1..107 100 -> Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2010-07-28 16:59:36 Download gff for LP15878.complete
Subject Subject Range Query Range Percent Splice Strand
CG14669-RA 1..234 480..713 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 16:26:22 Download gff for LP15878.complete
Subject Subject Range Query Range Percent Splice Strand
CG14669-RA 1..921 480..1400 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 02:32:37 Download gff for LP15878.complete
Subject Subject Range Query Range Percent Splice Strand
CG14669-RA 1..921 480..1400 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 17:10:27 Download gff for LP15878.complete
Subject Subject Range Query Range Percent Splice Strand
CG14669-RA 1..234 480..713 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 22:01:58 Download gff for LP15878.complete
Subject Subject Range Query Range Percent Splice Strand
CG14669-RA 1..921 480..1400 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-07-28 16:59:34 Download gff for LP15878.complete
Subject Subject Range Query Range Percent Splice Strand
CG14669-RA 1..3384 1..3384 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 16:26:22 Download gff for LP15878.complete
Subject Subject Range Query Range Percent Splice Strand
CG14669-RA 1..3384 1..3384 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 02:32:37 Download gff for LP15878.complete
Subject Subject Range Query Range Percent Splice Strand
CG14669-RA 372..3648 108..3384 100   Plus
CG14669-RA 27..135 1..107 98 -> Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 17:10:27 Download gff for LP15878.complete
Subject Subject Range Query Range Percent Splice Strand
CG14669-RA 1..3384 1..3384 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 22:01:58 Download gff for LP15878.complete
Subject Subject Range Query Range Percent Splice Strand
CG14669-RA 372..3648 108..3384 100   Plus
CG14669-RA 27..135 1..107 98 -> Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 22:01:58 Download gff for LP15878.complete
Subject Subject Range Query Range Percent Splice Strand
3R 5455451..5457600 1235..3384 100   Plus
3R 5455302..5455369 1167..1234 100 -> Plus
3R 5454809..5454922 1053..1166 100 -> Plus
3R 5454624..5454737 939..1052 100 -> Plus
3R 5442126..5442248 816..938 100 -> Plus
3R 5437136..5437649 302..815 100 -> Plus
3R 5416705..5416898 108..301 100 -> Plus
3R 5414553..5414659 1..107 100 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 02:32:37 Download gff for LP15878.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 1281173..1283322 1235..3384 100   Plus
arm_3R 1281024..1281091 1167..1234 100 -> Plus
arm_3R 1280531..1280644 1053..1166 100 -> Plus
arm_3R 1280346..1280459 939..1052 100 -> Plus
arm_3R 1267848..1267970 816..938 100 -> Plus
arm_3R 1262858..1263371 302..815 100 -> Plus
arm_3R 1242427..1242620 108..301 100 -> Plus
arm_3R 1240275..1240381 1..107 100 -> Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 13:46:56 Download gff for LP15878.complete
Subject Subject Range Query Range Percent Splice Strand
3R 5196282..5198431 1235..3384 100   Plus
3R 5196133..5196200 1167..1234 100 -> Plus
3R 5195640..5195753 1053..1166 100 -> Plus
3R 5195455..5195568 939..1052 100 -> Plus
3R 5182957..5183079 816..938 100 -> Plus
3R 5177967..5178480 302..815 100 -> Plus
3R 5157536..5157729 108..301 100 -> Plus
3R 5155384..5155490 1..107 100 -> Plus

LP15878.pep Sequence

Translation from 479 to 712

> LP15878.pep
MWSSTISPTNSKKLLIGSTRSVDYVGDSARTAAGNIKTGAAAAAGAKGSK
SKATATAPTTKISIEMELHIQNKCISA*

LP15878.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 09:08:20
Subject Length Description Subject Range Query Range Score Percent Strand
CG14669-PD 77 CG14669-PD 1..77 1..77 379 100 Plus
CG14669-PC 192 CG14669-PC 1..77 1..77 379 100 Plus
CG14669-PB 306 CG14669-PB 1..77 1..77 379 100 Plus
CG14669-PA 306 CG14669-PA 1..77 1..77 379 100 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2014-11-28 09:08:26
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA13161-PB 324 GA13161-PB 1..94 1..77 242 69.1 Plus

LP15878.hyp Sequence

Translation from 914 to 1399

> LP15878.hyp
MVLDVPPQKRFPADNFAEWNNGHPLGLRTVHAYVLVYDMGNLETFQYCRS
MRDQILDSFSHRDFSIIVVGNKFDNVTEAQANSQELKDISTLVRKHWRCG
YVECSAQYNYKIGDVFRELMGCTSAVGGGGAGGGGGVAGVGGLVGTEYSQ
STRNKGRCTIL*

LP15878.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 17:26:58
Subject Length Description Subject Range Query Range Score Percent Strand
CG14669-PB 306 CG14669-PB 146..306 1..161 866 100 Plus
CG14669-PA 306 CG14669-PA 146..306 1..161 866 100 Plus
CG13375-PC 277 CG13375-PC 70..181 2..120 157 32.5 Plus
CG13375-PB 306 CG13375-PB 99..210 2..120 157 32.5 Plus
CG13375-PA 306 CG13375-PA 99..210 2..120 157 32.5 Plus