Clone LP16156 Report

Search the DGRC for LP16156

Clone and Library Details

Library:LP
Tissue Source:Drosophila melanogaster larval-early pupal
Created by:Ling Hong
Date Registered:1998-06-11
Comments:Sized fractionated cDNAs were directly ligated into pOT2. Plasmid cDNA library.
Original Plate Number:161
Well:56
Vector:pOT2
Associated Gene/Transcriptine-RA
Protein status:LP16156.pep: gold
Sequenced Size:2237

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
ine-RA 2009-06-22 Replacement based on scoring

Clone Sequence Records

LP16156.complete Sequence

2237 bp assembled on 2009-09-22

GenBank Submission: BT099793.1

> LP16156.complete
CACAAACCGATCAGTTGCCACTCCCAGTTTCCACCAGTGCCCGCGTCTCC
TGATCCATGGATACCTTCATAGTTCAAAGGCTGCACTAGAAGTAACTCCT
GAATAAAAGATTAGAATAAGCCAAAGGAGTAAGCCAAGGTCGAGATGCCG
AACCGCCAGGACTACGATGCACAGTCCTCGAAGCACTCGGAACAGTCCTT
CTTCCGCTTCAACCGGGTGGCCAAAGTACCCCTGGGGGTGGATGACGATG
ACAGCTACCTGGACATGTCCGATGAGACGGCCCAGCTCAAGCCGCGCCAG
CAGCACTGGGCCAATAAGATGCAATTCGTCCTGGCCTGCATAGGATACTC
GGTGGGTCTGGGCAACGTCTGGCGTTTTCCGTACATGTGCTACAAGAGTG
GCGGTGGTGTTTTTCTAGTACCTTATTGCATAATACTGTTCATATGCAGC
ATTCCGCTGCTCTTCATGGAGCTGTCCGTTGGCCAATACACCGGTCGAGG
ACCCATTGGAGCACTGGGTCAACTGTGTCCTCTGTTCAAGGGAGCCGGAC
TCGCCAGCGTGGTCGTCTCGTTCCTCATGTCCACCTACTATAGTGTCATC
ATAGGCTACTCCATCTACTACTTCTTTACGTCGTTCAAAACGGAAATGCC
CTGGATCGACTGCAACAACAGGTGGAACACGCCCGATTGCTGGGTGCCAC
AGCGCAAGGGGATTAATGCCAGTGCGCCGGACACATCTCGCACTCCATCC
GAGGAATTCTTCGAAAACAAGGTCCTGCAGATCAGCGGTGGCCTGGAGTA
TCCGGGCATGATGCGCTGGGAGCTATTTGCCTGCCTGATCTGCGCCTGGC
TAATGGTCTACTTCGCCACGTGGAAGTCGATCAAGTCGTCGGCGAAGGTG
CGCTACTTCACGGCCACGTTTCCGTTCGTGCTGATCATCATCCTGATGGT
GCGCGCGGTGACCCTGGATGGAGCTGCTGAGGGTTTGCGCTTCTTCTTCC
GTCCCAAGTGGTCGGAGCTGAAGAACGCCAATGTGTGGATCAACGCCGCA
TCCCAGAACTTCAACTCGCTGGGCATTACATTCGGATCCATGATCTCCTT
TGCCAGCTACAACAAGTACAACAACAATATCCTGCGAGATACCGTGGCAG
TGAGTGCGGTGAATATGATCACCAGTCTCCTGGTGGGCATCTTTGCCTTC
TCCACGCTGGGCAATCTGGCGCTGGAGCAGAACACCAATGTGAGGGACGT
CATCGGTGATGGACCGGGCATGATATTCGTGGTGTATCCCCAGGCGATGG
CTAAGATGCCGTACGCTCAGCTCTGGGCGGTCATGTTCTTCTTCATGCTG
CTCTGCCTAGGTCTGAACTCGCAGTTTGCCATTGTGGAGGTTGTGGTCAC
GTCCATACAGGATGGCTTTCCGCGGTGGATCAAGCGGCACCTGGGCTATC
ACGAAATCGTGGTCCTGTTCGTCTGTGTCATCTCATGTCTCTTCGGGATG
CCCAACATCATACAGGGTGGCATCTACTACTTCCAGCTAATGGATCACTA
CGCCGCCTCCGTGACGATCATGTTTCTGGCCTTCTGTCAAATGATTGCCA
TTGCCTGGTTCTACGGCACGGGAAGACTGTCGAAGAACGTCAAGCAAATG
ACCGGAAAGGCGCCTTCGTTCTATCTCAGATCCTGCTGGCTAGTCCTGGG
ACCCTGCCTCCTCTTTGCCATCTGGGTATTGAGTCTGATCAACTACCACG
AGCCCACCTACCACAATGGACGCTATACCTATCCGGACTGGGCCTACGGA
ATAGGCTGGATGTTCGCTTCATTCTCGCTGATCTGCATACCTGGATATGC
GGTTATCAACTTCCTGCGCTCCAGTGGAGATACCTTTTGGGAACGCATCC
GGAACACGCTGAGACCCAACATCTACGAGTGCAAGATTTGCGGGGAACAC
CACTGCGAACACGACTATCCGGAGCAGGAGCAGTTTATGCTGGCCCAGGA
AATGGCCACAGTGTACAAGCCCACCAACCCACACCTGCTCAATCTCGGCC
AGAAGTGCGGCTACAACGCCATGCAAGCCTCACCCTCACATGCGGAGGCA
GGAGGACCATGTGGCCAGTAGCTGTTAGGAACCTCTCCCAACAATAGCCA
TTTCCGAGTATTTTTAACGAATCACTTGTGTAAGTTAAATGCAGAAATTA
AAGTATTTAAATAAATTCTAAAAAAAAAAAAAAAAAA

LP16156.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 16:49:02
Subject Length Description Subject Range Query Range Score Percent Strand
ine-RA 2270 ine-RA 16..2235 1..2220 11100 100 Plus
ine-RB 3666 ine-RB 1639..3631 228..2220 9965 100 Plus
ine-RE 3549 ine-RE 1541..3533 228..2220 9965 100 Plus
Blast to d_melanogaster_OreR.fa performed 2014-11-26 21:35:00
Subject Length Description Subject Range Query Range Score Percent Strand
chr2L 23010047 chr2L 4467797..4468749 1717..765 4705 99.6 Minus
chr2L 23010047 chr2L 4467167..4467492 2219..1894 1630 100 Minus
chr2L 23010047 chr2L 4472079..4472305 227..1 1105 99.1 Minus
chr2L 23010047 chr2L 4471108..4471288 408..228 890 99.4 Minus
chr2L 23010047 chr2L 4467556..4467732 1893..1717 885 100 Minus
chr2L 23010047 chr2L 4468963..4469097 675..541 675 100 Minus
chr2L 23010047 chr2L 4470123..4470259 542..406 670 99.3 Minus
chr2L 23010047 chr2L 4468806..4468901 764..669 480 100 Minus
chr2R 21145070 chr2R 20292941..20293050 1127..1018 190 78.2 Minus
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 21:34:56
Subject Length Description Subject Range Query Range Score Percent Strand
ine-RA 1977 CG15444-PA 1..1977 145..2121 9885 100 Plus
ine-RF 2832 CG15444-PF 939..2832 228..2121 9470 100 Plus
ine-RE 2832 CG15444-PE 939..2832 228..2121 9470 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 19:57:17 has no hits.
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 21:34:55
Subject Length Description Subject Range Query Range Score Percent Strand
ine-RA 2272 CG15444-RA 18..2236 1..2219 11095 100 Plus
ine-RF 3436 CG15444-RF 1439..3430 228..2219 9960 100 Plus
ine-RE 3458 CG15444-RE 1461..3452 228..2219 9960 100 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-26 21:34:59
Subject Length Description Subject Range Query Range Score Percent Strand
ine-PA 658 CG15444-PA 1..658 145..2118 3403 100 Plus
ine-PF 943 CG15444-PF 300..943 187..2118 3258 98.1 Plus
ine-PE 943 CG15444-PE 300..943 187..2118 3258 98.1 Plus
ine-PB 943 CG15444-PB 300..943 187..2118 3258 98.1 Plus
ine-PC 943 CG15444-PC 300..943 187..2118 3258 98.1 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 21:34:52
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 4468666..4469618 1717..765 4765 100 Minus
2L 23513712 2L 4468035..4468361 2220..1894 1635 100 Minus
2L 23513712 2L 4472949..4473175 227..1 1135 100 Minus
2L 23513712 2L 4471978..4472158 408..228 905 100 Minus
2L 23513712 2L 4468425..4468601 1893..1717 885 100 Minus
2L 23513712 2L 4470993..4471129 542..406 685 100 Minus
2L 23513712 2L 4469832..4469966 675..541 675 100 Minus
2L 23513712 2L 4469675..4469770 764..669 480 100 Minus
2R 25286936 2R 24407017..24407126 1127..1018 190 78.2 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 18:46:01
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 4468666..4469618 1717..765 4765 100 Minus
2L 23513712 2L 4468035..4468361 2220..1894 1635 100 Minus
2L 23513712 2L 4472949..4473175 227..1 1135 100 Minus
2L 23513712 2L 4471978..4472158 408..228 905 100 Minus
2L 23513712 2L 4468425..4468601 1893..1717 885 100 Minus
2L 23513712 2L 4470993..4471129 542..406 685 100 Minus
2L 23513712 2L 4469832..4469966 675..541 675 100 Minus
2L 23513712 2L 4469675..4469770 764..669 480 100 Minus
Blast to na_te.dros performed on 2014-11-26 21:34:53 has no hits.

LP16156.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2014-11-26 22:39:06 Download gff for LP16156.complete
Subject Subject Range Query Range Percent Splice Strand
chr2L 4472079..4472305 1..227 99   Minus
chr2L 4471110..4471288 228..406 99 <- Minus
chr2L 4470124..4470258 407..541 99 <- Minus
chr2L 4468967..4469096 542..671 100 <- Minus
chr2L 4468806..4468898 672..764 100 <- Minus
chr2L 4467798..4468749 765..1716 99 <- Minus
chr2L 4467556..4467732 1717..1893 100 <- Minus
chr2L 4467167..4467492 1894..2219 100 <- Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2009-10-19 17:54:56 Download gff for LP16156.complete
Subject Subject Range Query Range Percent Splice Strand
ine-RA 1..1977 145..2121 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 14:32:18 Download gff for LP16156.complete
Subject Subject Range Query Range Percent Splice Strand
ine-RA 1..1977 145..2121 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 05:33:00 Download gff for LP16156.complete
Subject Subject Range Query Range Percent Splice Strand
ine-RA 1..1977 145..2121 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 22:39:06 Download gff for LP16156.complete
Subject Subject Range Query Range Percent Splice Strand
ine-RA 1..1977 145..2121 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2009-09-22 09:10:45 Download gff for LP16156.complete
Subject Subject Range Query Range Percent Splice Strand
ine-RA 16..2234 1..2219 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 14:32:18 Download gff for LP16156.complete
Subject Subject Range Query Range Percent Splice Strand
ine-RA 16..2234 1..2219 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 05:33:00 Download gff for LP16156.complete
Subject Subject Range Query Range Percent Splice Strand
ine-RA 18..2236 1..2219 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 22:39:06 Download gff for LP16156.complete
Subject Subject Range Query Range Percent Splice Strand
ine-RA 18..2236 1..2219 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 22:39:06 Download gff for LP16156.complete
Subject Subject Range Query Range Percent Splice Strand
2L 4472949..4473175 1..227 100   Minus
2L 4471980..4472158 228..406 100 <- Minus
2L 4470994..4471128 407..541 100 <- Minus
2L 4469836..4469965 542..671 100 <- Minus
2L 4469675..4469767 672..764 100 <- Minus
2L 4468667..4469618 765..1716 100 <- Minus
2L 4468425..4468601 1717..1893 100 <- Minus
2L 4468036..4468361 1894..2219 100 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 05:33:00 Download gff for LP16156.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 4472949..4473175 1..227 100   Minus
arm_2L 4471980..4472158 228..406 100 <- Minus
arm_2L 4470994..4471128 407..541 100 <- Minus
arm_2L 4469836..4469965 542..671 100 <- Minus
arm_2L 4469675..4469767 672..764 100 <- Minus
arm_2L 4468667..4469618 765..1716 100 <- Minus
arm_2L 4468425..4468601 1717..1893 100 <- Minus
arm_2L 4468036..4468361 1894..2219 100 <- Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 12:16:51 Download gff for LP16156.complete
Subject Subject Range Query Range Percent Splice Strand
2L 4472949..4473175 1..227 100   Minus
2L 4471980..4472158 228..406 100 <- Minus
2L 4470994..4471128 407..541 100 <- Minus
2L 4469836..4469965 542..671 100 <- Minus
2L 4469675..4469767 672..764 100 <- Minus
2L 4468667..4469618 765..1716 100 <- Minus
2L 4468425..4468601 1717..1893 100 <- Minus
2L 4468036..4468361 1894..2219 100 <- Minus

LP16156.pep Sequence

Translation from 144 to 2120

> LP16156.pep
MPNRQDYDAQSSKHSEQSFFRFNRVAKVPLGVDDDDSYLDMSDETAQLKP
RQQHWANKMQFVLACIGYSVGLGNVWRFPYMCYKSGGGVFLVPYCIILFI
CSIPLLFMELSVGQYTGRGPIGALGQLCPLFKGAGLASVVVSFLMSTYYS
VIIGYSIYYFFTSFKTEMPWIDCNNRWNTPDCWVPQRKGINASAPDTSRT
PSEEFFENKVLQISGGLEYPGMMRWELFACLICAWLMVYFATWKSIKSSA
KVRYFTATFPFVLIIILMVRAVTLDGAAEGLRFFFRPKWSELKNANVWIN
AASQNFNSLGITFGSMISFASYNKYNNNILRDTVAVSAVNMITSLLVGIF
AFSTLGNLALEQNTNVRDVIGDGPGMIFVVYPQAMAKMPYAQLWAVMFFF
MLLCLGLNSQFAIVEVVVTSIQDGFPRWIKRHLGYHEIVVLFVCVISCLF
GMPNIIQGGIYYFQLMDHYAASVTIMFLAFCQMIAIAWFYGTGRLSKNVK
QMTGKAPSFYLRSCWLVLGPCLLFAIWVLSLINYHEPTYHNGRYTYPDWA
YGIGWMFASFSLICIPGYAVINFLRSSGDTFWERIRNTLRPNIYECKICG
EHHCEHDYPEQEQFMLAQEMATVYKPTNPHLLNLGQKCGYNAMQASPSHA
EAGGPCGQ*

LP16156.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2014-11-28 07:26:52
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF23979-PA 949 GF23979-PA 296..927 15..646 3272 94.9 Plus
Dana\GF11257-PA 752 GF11257-PA 37..611 33..592 1159 37.8 Plus
Dana\GF12191-PA 636 GF12191-PA 53..610 47..590 1136 39.6 Plus
Dana\GF11259-PA 594 GF11259-PA 8..559 26..591 1115 39.1 Plus
Dana\GF12508-PA 1163 GF12508-PA 58..666 55..637 1077 37.3 Plus
Blast to dere-all-translation-r1.3.fasta performed 2014-11-28 07:26:54
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG24369-PA 944 GG24369-PA 302..938 15..651 3341 96.2 Plus
Dere\GG19936-PA 770 GG19936-PA 74..618 52..612 1164 38.7 Plus
Dere\GG22262-PA 631 GG22262-PA 10..585 26..579 1156 39.3 Plus
Dere\GG16396-PA 636 GG16396-PA 42..610 40..590 1152 40 Plus
Dere\GG22890-PA 1201 GG22890-PA 62..639 55..606 1074 38.8 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2014-11-28 07:26:55
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH13744-PA 997 GH13744-PA 321..966 1..646 3164 91.2 Plus
Dgri\GH20902-PA 627 GH20902-PA 77..612 49..592 1162 39.7 Plus
Dgri\GH20642-PA 627 GH20642-PA 3..594 29..591 1162 38.4 Plus
Dgri\GH14803-PA 636 GH14803-PA 40..611 34..590 1146 38.2 Plus
Dgri\GH22876-PA 1848 GH22876-PA 518..1087 44..592 1097 38.2 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 07:26:51
Subject Length Description Subject Range Query Range Score Percent Strand
ine-PA 658 CG15444-PA 1..658 1..658 3562 100 Plus
ine-PF 943 CG15444-PF 300..943 15..658 3417 98.1 Plus
ine-PE 943 CG15444-PE 300..943 15..658 3417 98.1 Plus
ine-PB 943 CG15444-PB 300..943 15..658 3417 98.1 Plus
ine-PC 943 CG15444-PC 300..943 15..658 3417 98.1 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2014-11-28 07:26:56
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI17887-PA 998 GI17887-PA 326..974 1..653 3227 91.4 Plus
Dmoj\GI18339-PA 763 GI18339-PA 56..624 33..592 1159 38.1 Plus
Dmoj\GI19005-PA 626 GI19005-PA 24..593 51..591 1152 39.2 Plus
Dmoj\GI11503-PA 633 GI11503-PA 54..610 50..592 1147 39.5 Plus
Dmoj\GI21256-PA 685 GI21256-PA 37..612 34..592 1089 38.4 Plus
Blast to dper-all-translation-r1.3.fasta performed 2014-11-28 07:26:58
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL16025-PA 886 GL16025-PA 223..864 15..651 3183 93.5 Plus
Dper\GL21405-PA 271 GL21405-PA 1..249 376..651 1174 80.1 Plus
Dper\GL20450-PA 630 GL20450-PA 47..615 33..592 1157 38.2 Plus
Dper\GL18181-PA 634 GL18181-PA 54..608 50..590 1139 39.6 Plus
Dper\GL11339-PA 634 GL11339-PA 6..588 24..579 1129 38 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2014-11-28 07:26:59
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA13735-PA 886 GA13735-PA 223..864 15..651 3183 93.5 Plus
Dpse\GA25115-PA 630 GA25115-PA 47..615 33..592 1157 38.2 Plus
Dpse\GA21033-PA 634 GA21033-PA 6..588 24..579 1129 38 Plus
Dpse\GA18963-PA 1262 GA18963-PA 113..708 35..606 1054 36.8 Plus
Dpse\GA20082-PA 586 GA20082-PA 21..550 52..591 980 37.5 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2014-11-28 07:27:00
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM18085-PA 943 GM18085-PA 300..943 15..658 3335 97.2 Plus
Dsec\GM11839-PA 747 GM11839-PA 33..618 33..612 1167 37.4 Plus
Dsec\GM20052-PA 631 GM20052-PA 10..585 26..579 1154 39.3 Plus
Dsec\GM26805-PA 636 GM26805-PA 42..610 40..590 1149 39.7 Plus
Dsec\GM16050-PA 1193 GM16050-PA 59..636 55..606 1068 38.6 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2014-11-28 07:27:02
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD22703-PA 262 GD22703-PA 1..262 397..658 1423 99.2 Plus
Dsim\GD25533-PA 631 GD25533-PA 10..585 26..579 1156 39.3 Plus
Dsim\GD11799-PA 1106 GD11799-PA 52..644 51..606 1030 37.4 Plus
Dsim\GD23482-PA 590 GD23482-PA 14..554 42..591 964 37.7 Plus
Dsim\GD25364-PA 561 GD25364-PA 6..547 39..592 915 36 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2014-11-28 07:27:03
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ17389-PA 1001 GJ17389-PA 326..970 1..646 3195 92.1 Plus
Dvir\GJ20736-PA 630 GJ20736-PA 41..616 33..593 1155 37.9 Plus
Dvir\GJ19971-PA 627 GJ19971-PA 6..593 24..591 1147 38.4 Plus
Dvir\GJ13697-PA 635 GJ13697-PA 51..610 45..590 1141 39 Plus
Dvir\GJ20857-PA 1283 GJ20857-PA 637..1214 36..592 1112 38.6 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2014-11-28 07:27:05
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK23923-PA 958 GK23923-PA 300..933 15..646 3247 94 Plus
Dwil\GK22085-PA 634 GK22085-PA 85..630 51..612 1163 38.8 Plus
Dwil\GK21599-PA 664 GK21599-PA 33..629 25..591 1139 37.8 Plus
Dwil\GK13698-PA 632 GK13698-PA 42..606 42..590 1135 39.1 Plus
Dwil\GK22198-PA 1135 GK22198-PA 25..625 32..606 1098 37.5 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2014-11-28 07:27:06
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE14708-PA 944 GE14708-PA 301..944 15..658 3323 96.1 Plus
Dyak\GE11465-PA 764 GE11465-PA 74..618 52..612 1163 38.7 Plus
Dyak\GE14056-PA 631 GE14056-PA 10..585 26..579 1149 38.9 Plus
Dyak\GE14556-PA 636 GE14556-PA 56..610 50..590 1143 40.1 Plus
Dyak\GE14327-PA 562 GE14327-PA 59..539 51..510 1000 41.2 Plus

LP16156.hyp Sequence

Translation from 144 to 2120

> LP16156.hyp
MPNRQDYDAQSSKHSEQSFFRFNRVAKVPLGVDDDDSYLDMSDETAQLKP
RQQHWANKMQFVLACIGYSVGLGNVWRFPYMCYKSGGGVFLVPYCIILFI
CSIPLLFMELSVGQYTGRGPIGALGQLCPLFKGAGLASVVVSFLMSTYYS
VIIGYSIYYFFTSFKTEMPWIDCNNRWNTPDCWVPQRKGINASAPDTSRT
PSEEFFENKVLQISGGLEYPGMMRWELFACLICAWLMVYFATWKSIKSSA
KVRYFTATFPFVLIIILMVRAVTLDGAAEGLRFFFRPKWSELKNANVWIN
AASQNFNSLGITFGSMISFASYNKYNNNILRDTVAVSAVNMITSLLVGIF
AFSTLGNLALEQNTNVRDVIGDGPGMIFVVYPQAMAKMPYAQLWAVMFFF
MLLCLGLNSQFAIVEVVVTSIQDGFPRWIKRHLGYHEIVVLFVCVISCLF
GMPNIIQGGIYYFQLMDHYAASVTIMFLAFCQMIAIAWFYGTGRLSKNVK
QMTGKAPSFYLRSCWLVLGPCLLFAIWVLSLINYHEPTYHNGRYTYPDWA
YGIGWMFASFSLICIPGYAVINFLRSSGDTFWERIRNTLRPNIYECKICG
EHHCEHDYPEQEQFMLAQEMATVYKPTNPHLLNLGQKCGYNAMQASPSHA
EAGGPCGQ*

LP16156.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 17:21:01
Subject Length Description Subject Range Query Range Score Percent Strand
ine-PA 658 CG15444-PA 1..658 1..658 3562 100 Plus
ine-PF 943 CG15444-PF 300..943 15..658 3417 98.1 Plus
ine-PE 943 CG15444-PE 300..943 15..658 3417 98.1 Plus
ine-PB 943 CG15444-PB 300..943 15..658 3417 98.1 Plus
ine-PC 943 CG15444-PC 300..943 15..658 3417 98.1 Plus