Clone LP16188 Report

Search the DGRC for LP16188

Clone and Library Details

Library:LP
Tissue Source:Drosophila melanogaster larval-early pupal
Created by:Ling Hong
Date Registered:1998-06-11
Comments:Sized fractionated cDNAs were directly ligated into pOT2. Plasmid cDNA library.
Original Plate Number:161
Well:88
Vector:pOT2
Associated Gene/TranscriptRpt4-RB
Protein status:LP16188.pep: gold
Sequenced Size:1410

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
Rpt4-RA 2009-01-27 EST screening

Clone Sequence Records

LP16188.complete Sequence

1410 bp assembled on 2009-04-03

GenBank Submission: BT081387.1

> LP16188.complete
CGAAAGTACAGCGTAAATCCTCGAACAAGATGACCGTGACCGCCACACCG
ATGCCGGACAATCTGCGGGTGAAAGCCTTATCCGAGTACCGAAAGAAGTT
GCTAGAGCACAAGGAAATCGAGGGACGCCTCAAAGAAAAGCGCGAGGAGA
TCAAGGATCTGACCAAGCTGTACGACAAGTCGGAGAACGATCTAAAGGCC
CTGCAGAGCGTGGGACAGATCGTTGGTGAGGTGCTGAAGCAGCTGACCGA
GGATAAATTCATTGTGAAGGCCACCAATGGACCCCGCTACGTGGTCGGCT
GCCGCCGGCAGCTGGACAAAGCCAAGCTGAAGTCCGGAACTCGTGTGGCC
CTCGACATGACCACACTGACCATTATGCGCTACTTGCCGCGCGAGGTGGA
CCCACTGGTGTACAATATGTCGCACGAGGATCCCGGGGATGTCACCTACT
CGGCCATCGGCGGCCTAACCGACCAAATTCGCGAGCTGCGCGAAGTGATC
GAGCTGCCCCTACTGAATCCGGAGCTCTTCCTGCGCGTCGGCATCACGCC
ACCGAAGGGTTGTTTGCTGTACGGACCTCCTGGCACCGGCAAGACCCTGC
TGGCCCGTGCAGTGGCCTCCCAGCTGGACGCCAACTTCCTCAAGGTCGTG
TCCTCGGCGATTGTCGACAAGTATATTGGCGAGAGTGCGCGTCTCATTCG
CGAGATGTTCAACTATGCCCGCGACCATCAGCCCTGCATCATTTTCATGG
ACGAAATCGACGCTATCGGTGGTCGGCGCTTCTCCGAGGGCACCTCTGCC
GATCGCGAGATCCAGCGCACCCTGATGGAGCTGCTCAACCAGATGGACGG
CTTCGATTCGCTTGGCCAAGTCAAGATGATCATGGCAACCAATCGTCCGG
ACACCCTCGATCCTGCCCTTCTGCGTCCGGGTCGCTTGGACAGGAAGATC
GAGATTCCGCTGCCCAACGAGCAGGCTAGGTTGGAAATTCTCAAGATTCA
CGCACTGAAGATCGCCAAGCACGGCGAAATCGACTACGAGGCCATTGTCA
AGCTGTCGGACAACTTTAATGGCGCTGATCTGCGTAATGTCTGCACGGAG
GCGGGTCTCTTTGCCATTCGTGCGGAGCGGGAGTACGTCATCCAGGAGGA
CTTCATGAAGGCGGTGCGCAAGGTGTCGGACAACAAGAAGTTGGAGAGCA
AGCTGGACTACAAGCCCGTCTAGGAGCCAGTGCTCGCCACCGCCCCCCAT
AGAGATAACCATACACCATTTACACACATATACAGATATATATATATTAT
GCCCACAACGGGCCTGTCACACAAAGTCCGTTGCTTCTTCTCCATATGCT
AATTAAATGCTATGTAAAGATTAAAAAAAAAAAAAAAAAAAAAAAAAAAA
AAAAAAAAAA

LP16188.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 21:28:57
Subject Length Description Subject Range Query Range Score Percent Strand
Rpt4-RA 1465 Rpt4-RA 92..1464 1..1373 6865 100 Plus
Rpt4.a 1465 Rpt4.a 92..1464 1..1373 6865 100 Plus
Rpt4R-RA 1588 Rpt4R-RA 640..1094 474..928 1045 81.9 Plus
Rpt4R-RA 1588 Rpt4R-RA 336..602 170..436 525 79.7 Plus
Blast to d_melanogaster_OreR.fa performed 2014-11-27 08:20:41
Subject Length Description Subject Range Query Range Score Percent Strand
chrX 22417052 chrX 6182238..6182960 981..259 3525 99.2 Minus
chrX 22417052 chrX 6181655..6181907 1372..1120 1250 99.6 Minus
chr3L 24539361 chr3L 11933639..11934213 642..1216 910 77.2 Plus
chr3L 24539361 chr3L 11933095..11933572 170..647 785 77.6 Plus
chrX 22417052 chrX 6181970..6182113 1120..977 720 100 Minus
chrX 22417052 chrX 6183200..6183337 138..1 675 99.3 Minus
chrX 22417052 chrX 6183024..6183143 258..139 600 100 Minus
chr2R 21145070 chr2R 3540131..3540333 941..739 205 73.4 Minus
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 08:20:37
Subject Length Description Subject Range Query Range Score Percent Strand
Rpt4-RB 1194 CG3455-PB 1..1194 30..1223 5970 100 Plus
Rpt4R-RB 1197 CG7257-PB 144..1190 170..1216 1665 77.3 Plus
Rpt4R-RA 1197 CG7257-PA 144..1190 170..1216 1665 77.3 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 19:57:23 has no hits.
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 08:20:36
Subject Length Description Subject Range Query Range Score Percent Strand
Rpt4-RB 1465 CG3455-RB 94..1465 1..1372 6860 100 Plus
Rpt4R-RB 1502 CG7257-RB 336..1382 170..1216 1665 77.3 Plus
Rpt4R-RA 1391 CG7257-RA 225..1271 170..1216 1665 77.3 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 08:20:40
Subject Length Description Subject Range Query Range Score Percent Strand
Rpt4-PB 397 CG3455-PB 1..397 30..1220 2011 100 Plus
Rpt4R-PB 398 CG7257-PB 6..398 42..1220 1695 82.7 Plus
Rpt4R-PA 398 CG7257-PA 6..398 42..1220 1695 82.7 Plus
Rpt1-PA 433 CG1341-PA 33..416 63..1175 864 45 Plus
Rpt6-PA 405 CG1489-PA 24..389 69..1175 862 48 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 08:20:34
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 6290053..6290775 981..259 3615 100 Minus
X 23542271 X 6289469..6289722 1373..1120 1270 100 Minus
3L 28110227 3L 11942791..11943365 642..1216 910 77.2 Plus
3L 28110227 3L 11942247..11942724 170..647 785 77.6 Plus
X 23542271 X 6289785..6289928 1120..977 720 100 Minus
X 23542271 X 6291015..6291152 138..1 690 100 Minus
X 23542271 X 6290839..6290958 258..139 600 100 Minus
2R 25286936 2R 7652824..7653026 941..739 205 73.4 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:45:37
Subject Length Description Subject Range Query Range Score Percent Strand
X 23527363 X 6298151..6298873 981..259 3615 100 Minus
X 23527363 X 6297567..6297820 1373..1120 1270 100 Minus
3L 28103327 3L 11935891..11936177 642..928 745 83.9 Plus
X 23527363 X 6297883..6298026 1120..977 720 100 Minus
X 23527363 X 6299113..6299250 138..1 690 100 Minus
X 23527363 X 6298937..6299056 258..139 600 100 Minus
3L 28103327 3L 11935347..11935613 170..436 525 79.7 Plus
3L 28103327 3L 11935651..11935824 474..647 330 79.3 Plus
X 23527363 X 11134368..11134427 798..857 195 88.3 Plus
Blast to na_te.dros performed on 2014-11-27 08:20:35 has no hits.

LP16188.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2014-11-27 10:23:42 Download gff for LP16188.complete
Subject Subject Range Query Range Percent Splice Strand
chrX 6183200..6183337 1..138 99   Minus
chrX 6183024..6183143 139..258 100 <- Minus
chrX 6182240..6182960 259..979 99 <- Minus
chrX 6181970..6182110 980..1120 100 <- Minus
chrX 6181655..6181906 1121..1372 99 <- Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2009-10-19 18:08:30 Download gff for LP16188.complete
Subject Subject Range Query Range Percent Splice Strand
Rpt4-RA 1..1173 51..1223 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 21:43:20 Download gff for LP16188.complete
Subject Subject Range Query Range Percent Splice Strand
Rpt4-RA 1..1173 51..1223 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 13:55:40 Download gff for LP16188.complete
Subject Subject Range Query Range Percent Splice Strand
Rpt4-RB 1..1194 30..1223 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 10:23:42 Download gff for LP16188.complete
Subject Subject Range Query Range Percent Splice Strand
Rpt4-RB 1..1194 30..1223 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2009-04-03 15:35:29 Download gff for LP16188.complete
Subject Subject Range Query Range Percent Splice Strand
Rpt4-RA 92..1463 1..1372 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 21:43:20 Download gff for LP16188.complete
Subject Subject Range Query Range Percent Splice Strand
Rpt4-RA 92..1463 1..1372 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 13:55:40 Download gff for LP16188.complete
Subject Subject Range Query Range Percent Splice Strand
Rpt4-RB 94..1465 1..1372 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 10:23:42 Download gff for LP16188.complete
Subject Subject Range Query Range Percent Splice Strand
Rpt4-RB 94..1465 1..1372 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 10:23:42 Download gff for LP16188.complete
Subject Subject Range Query Range Percent Splice Strand
X 6291015..6291152 1..138 100   Minus
X 6290839..6290958 139..258 100 <- Minus
X 6290055..6290775 259..979 100 <- Minus
X 6289785..6289925 980..1120 100 <- Minus
X 6289470..6289721 1121..1372 100 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 13:55:40 Download gff for LP16188.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 6185048..6185185 1..138 100   Minus
arm_X 6184872..6184991 139..258 100 <- Minus
arm_X 6184088..6184808 259..979 100 <- Minus
arm_X 6183818..6183958 980..1120 100 <- Minus
arm_X 6183503..6183754 1121..1372 100 <- Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 19:18:18 Download gff for LP16188.complete
Subject Subject Range Query Range Percent Splice Strand
X 6299113..6299250 1..138 100   Minus
X 6298937..6299056 139..258 100 <- Minus
X 6298153..6298873 259..979 100 <- Minus
X 6297883..6298023 980..1120 100 <- Minus
X 6297568..6297819 1121..1372 100 <- Minus

LP16188.pep Sequence

Translation from 2 to 1222

> LP16188.pep
KVQRKSSNKMTVTATPMPDNLRVKALSEYRKKLLEHKEIEGRLKEKREEI
KDLTKLYDKSENDLKALQSVGQIVGEVLKQLTEDKFIVKATNGPRYVVGC
RRQLDKAKLKSGTRVALDMTTLTIMRYLPREVDPLVYNMSHEDPGDVTYS
AIGGLTDQIRELREVIELPLLNPELFLRVGITPPKGCLLYGPPGTGKTLL
ARAVASQLDANFLKVVSSAIVDKYIGESARLIREMFNYARDHQPCIIFMD
EIDAIGGRRFSEGTSADREIQRTLMELLNQMDGFDSLGQVKMIMATNRPD
TLDPALLRPGRLDRKIEIPLPNEQARLEILKIHALKIAKHGEIDYEAIVK
LSDNFNGADLRNVCTEAGLFAIRAEREYVIQEDFMKAVRKVSDNKKLESK
LDYKPV*

LP16188.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2014-11-26 17:17:00
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF21021-PA 397 GF21021-PA 1..397 10..406 2066 98.5 Plus
Dana\GF24499-PA 398 GF24499-PA 8..398 16..406 1780 84.7 Plus
Dana\GF21725-PA 405 GF21725-PA 43..389 42..391 883 50 Plus
Dana\GF23322-PA 402 GF23322-PA 67..386 71..391 849 52 Plus
Dana\GF17023-PA 446 GF17023-PA 57..437 22..396 798 42.5 Plus
Blast to dere-all-translation-r1.3.fasta performed 2014-11-26 17:17:02
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG17681-PA 397 GG17681-PA 1..397 10..406 2068 98.7 Plus
Dere\GG15543-PA 398 GG15543-PA 6..398 14..406 1743 82.4 Plus
Dere\GG19719-PA 405 GG19719-PA 43..389 42..391 881 50 Plus
Dere\GG11925-PA 401 GG11925-PA 66..385 71..391 838 51.4 Plus
Dere\GG12390-PA 439 GG12390-PA 50..430 22..396 798 42.5 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2014-11-26 17:17:03
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH17814-PA 397 GH17814-PA 1..397 10..406 2014 96.2 Plus
Dgri\GH18966-PA 398 GH18966-PA 5..398 13..406 1773 83.5 Plus
Dgri\GH11847-PA 405 GH11847-PA 43..389 42..391 881 50 Plus
Dgri\GH14117-PA 407 GH14117-PA 71..391 71..391 839 51.4 Plus
Dgri\GH19692-PA 439 GH19692-PA 50..430 22..396 797 42.5 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-26 17:16:58
Subject Length Description Subject Range Query Range Score Percent Strand
Rpt4-PB 397 CG3455-PB 1..397 10..406 2011 100 Plus
Rpt4R-PB 398 CG7257-PB 6..398 14..406 1695 82.7 Plus
Rpt4R-PA 398 CG7257-PA 6..398 14..406 1695 82.7 Plus
Rpt1-PA 433 CG1341-PA 33..416 21..391 864 45 Plus
Rpt6-PA 405 CG1489-PA 24..389 23..391 862 48 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2014-11-26 17:17:05
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI16424-PA 397 GI16424-PA 1..397 10..406 2032 97 Plus
Dmoj\GI23296-PA 393 GI23296-PA 1..393 10..406 1757 83.4 Plus
Dmoj\GI14329-PA 405 GI14329-PA 43..389 42..391 880 50 Plus
Dmoj\GI10644-PA 404 GI10644-PA 33..388 26..391 880 48.6 Plus
Dmoj\GI22277-PA 439 GI22277-PA 58..430 30..396 797 43.2 Plus
Blast to dper-all-translation-r1.3.fasta performed 2014-11-26 17:17:07
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL20276-PA 397 GL20276-PA 1..397 10..406 2061 98.2 Plus
Dper\GL25072-PA 389 GL25072-PA 5..389 22..406 1703 81.3 Plus
Dper\GL27100-PA 413 GL27100-PA 28..399 19..389 793 43.5 Plus
Dper\GL23235-PA 386 GL23235-PA 19..372 49..389 771 43.5 Plus
Dper\GL16409-PA 269 GL16409-PA 8..253 146..391 768 57.7 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2014-11-26 17:17:08
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA17461-PA 397 GA17461-PA 1..397 10..406 2061 98.2 Plus
Dpse\GA20215-PA 389 GA20215-PA 5..389 22..406 1703 81.3 Plus
Dpse\GA13327-PA 405 GA13327-PA 43..389 42..391 882 50 Plus
Dpse\GA12266-PB 433 GA12266-PB 33..416 21..391 877 45.2 Plus
Dpse\GA26607-PA 405 GA26607-PA 70..389 71..391 845 52.6 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2014-11-26 17:17:10
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM25309-PA 398 GM25309-PA 6..398 14..406 1754 83 Plus
Dsec\GM23074-PA 405 GM23074-PA 43..389 42..391 881 50 Plus
Dsec\GM12144-PA 400 GM12144-PA 65..384 71..391 840 51.7 Plus
Dsec\GM23527-PA 439 GM23527-PA 50..430 22..396 798 42.5 Plus
Dsec\GM26216-PA 389 GM26216-PA 46..375 60..389 767 43.9 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2014-11-26 17:17:11
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD14340-PA 398 GD14340-PA 6..398 14..406 1754 83 Plus
Dsim\GD17527-PA 405 GD17527-PA 43..389 42..391 881 50 Plus
Dsim\GD16958-PA 400 GD16958-PA 65..384 71..391 839 51.7 Plus
Dsim\GD18337-PA 439 GD18337-PA 50..430 22..396 798 42.5 Plus
Dsim\GD20762-PA 389 GD20762-PA 46..375 60..389 767 43.9 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2014-11-26 17:17:13
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ15827-PA 397 GJ15827-PA 1..397 10..406 2027 96.5 Plus
Dvir\GJ24151-PA 399 GJ24151-PA 15..399 22..406 1755 85.2 Plus
Dvir\GJ19383-PA 405 GJ19383-PA 43..389 42..391 881 50 Plus
Dvir\GJ23001-PA 408 GJ23001-PA 46..392 42..391 881 49.7 Plus
Dvir\GJ24070-PA 444 GJ24070-PA 55..435 22..396 798 42.5 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2014-11-26 17:17:14
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK25687-PA 397 GK25687-PA 1..397 10..406 2057 98 Plus
Dwil\GK23803-PA 397 GK23803-PA 1..397 10..406 2038 97 Plus
Dwil\GK12330-PA 408 GK12330-PA 21..408 19..406 1687 79.9 Plus
Dwil\GK12331-PA 403 GK12331-PA 19..403 22..406 1643 78.4 Plus
Dwil\GK16292-PA 405 GK16292-PA 43..389 42..391 881 50 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2014-11-26 17:17:16
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE16469-PA 397 GE16469-PA 1..397 10..406 2071 99 Plus
Dyak\GE21865-PA 398 GE21865-PA 14..398 22..406 1743 83.9 Plus
Dyak\GE17917-PA 405 GE17917-PA 43..389 42..391 881 50 Plus
Dyak\GE23375-PA 401 GE23375-PA 66..385 71..391 837 51.4 Plus
Dyak\GE10845-PA 439 GE10845-PA 50..430 22..396 798 42.5 Plus

LP16188.hyp Sequence

Translation from 2 to 1222

> LP16188.hyp
KVQRKSSNKMTVTATPMPDNLRVKALSEYRKKLLEHKEIEGRLKEKREEI
KDLTKLYDKSENDLKALQSVGQIVGEVLKQLTEDKFIVKATNGPRYVVGC
RRQLDKAKLKSGTRVALDMTTLTIMRYLPREVDPLVYNMSHEDPGDVTYS
AIGGLTDQIRELREVIELPLLNPELFLRVGITPPKGCLLYGPPGTGKTLL
ARAVASQLDANFLKVVSSAIVDKYIGESARLIREMFNYARDHQPCIIFMD
EIDAIGGRRFSEGTSADREIQRTLMELLNQMDGFDSLGQVKMIMATNRPD
TLDPALLRPGRLDRKIEIPLPNEQARLEILKIHALKIAKHGEIDYEAIVK
LSDNFNGADLRNVCTEAGLFAIRAEREYVIQEDFMKAVRKVSDNKKLESK
LDYKPV*

LP16188.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 17:00:03
Subject Length Description Subject Range Query Range Score Percent Strand
Rpt4-PB 397 CG3455-PB 1..397 10..406 2011 100 Plus
Rpt4R-PB 398 CG7257-PB 6..398 14..406 1695 82.7 Plus
Rpt4R-PA 398 CG7257-PA 6..398 14..406 1695 82.7 Plus
Rpt1-PA 433 CG1341-PA 33..416 21..391 864 45 Plus
Rpt6-PA 405 CG1489-PA 24..389 23..391 862 48 Plus