Clone LP18071 Report

Search the DGRC for LP18071

Clone and Library Details

Library:LP
Tissue Source:Drosophila melanogaster larval-early pupal
Created by:Ling Hong
Date Registered:1998-06-11
Comments:Sized fractionated cDNAs were directly ligated into pOT2. Plasmid cDNA library.
Original Plate Number:180
Well:71
Vector:pOT2
Associated Gene/TranscriptCG15347-RB
Protein status:LP18071.pep: gold
Sequenced Size:999

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG15347 2010-12-02 CDS novel splice

Clone Sequence Records

LP18071.complete Sequence

999 bp assembled on 2011-02-18

GenBank Submission: BT126089.1

> LP18071.complete
TAACCAGTCGCAACATTCGATCGTCGTGAAATTAGTTACATCAGTTATCA
GCCATGAAGTTTTACCTGTTGGTGATTGCAGCCCTCTCGTTTTTGGCCTA
CATCAGTTGTGGCATGACTCAATCGAAACGCTCCGTTCCACTCGCTCAAT
TTGCAGATGGATGCATCCAGTGCAATTCGAAGGACAACGAACGCTGCGCC
ACAGATCCATTGAGCCTGCTCAATCGCAACTGTTCCGATGGATCCTCCAA
CTGCTATTCCCGCGTCCTGGATGGCTACACAATTCGCGGCTGTGCCGTCG
ATCTGGACAACGCCACGCGTAATTCGTGCAACAACGAGCTACTGTGCCAG
CTGTGCACCTACAGCGAGGGATGCAATCGAAACACCTTCCCGTTGAGCCG
CCTCATGTGCCTACAGTGCACAGGGAACTCGACCTCGTCGTCCTGCGCCA
CAGAGACCTATGTATCGGCCAAGATCTGCCCGCTGTACAAGTTCGGCGAC
AAGTGCTACATTCGCAATAGCAATCGCACCGTGGACGGATCCTTCCAGCG
CGGCTGTCTCACCTCGGCGAATGCCAGGAAGCAGTGCGTCAAGGATGGCA
ACTGTTATACGTGCGAGGGACGCGGCTGCAACTTTCTGCTGGCCAATGAT
ACCAACATTCCGCTGGCACGCGACAGCGGTGCCCAGTTGATCATCTCCAT
GACGCTGCTGATCAGCGGTCTTGTCGCCGCCTGGAGACTCTAAGATGTAA
CGACGGCCAGAGTCGAATGATGGACGAAAGTCAATCATGCCACAGACCCA
GTTCTTTTAGAAATTCCCGTCTTATTATTTTCTACATTCTAAAACATCAT
TATACATACATACATACACTGGGATGTTACATTTATACTCGTTTATTTCA
TTACTTTGAACAAAACGTTAATAAAGATAACTAAACTAAAGAAGACAAAA
AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA

LP18071.complete Blast Records

Blast to d_melanogaster_OreR.fa performed 2014-11-27 17:20:58
Subject Length Description Subject Range Query Range Score Percent Strand
chrX 22417052 chrX 8350271..8350947 946..270 3370 99.9 Minus
chrX 22417052 chrX 8351001..8351160 270..111 800 100 Minus
chrX 22417052 chrX 8352543..8352654 112..1 560 100 Minus
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 17:20:54
Subject Length Description Subject Range Query Range Score Percent Strand
CG15347-RB 690 CG15347-PB 1..690 54..743 3450 100 Plus
CG15347-RA 645 CG15347-PA 58..645 156..743 2940 100 Plus
CG15347-RA 645 CG15347-PA 1..58 54..111 290 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 17:20:53
Subject Length Description Subject Range Query Range Score Percent Strand
CG15347-RB 968 CG15347-RB 23..968 1..946 4730 100 Plus
CG15347-RA 923 CG15347-RA 133..923 156..946 3955 100 Plus
CG15347-RA 923 CG15347-RA 23..133 1..111 555 100 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 17:20:56
Subject Length Description Subject Range Query Range Score Percent Strand
CG15347-PB 229 CG15347-PB 1..229 54..740 1231 100 Plus
CG15347-PA 214 CG15347-PA 1..214 54..740 1132 93.4 Plus
CG13492-PD 2979 CG13492-PD 2799..2975 162..731 204 26.9 Plus
CG13492-PD 2979 CG13492-PD 1538..1695 162..632 184 31.7 Plus
CG13492-PD 2979 CG13492-PD 2372..2540 132..647 180 31.5 Plus
CG13492-PD 2979 CG13492-PD 1956..2114 132..632 177 33.1 Plus
CG13492-PD 2979 CG13492-PD 698..849 162..632 176 31.1 Plus
CG13492-PD 2979 CG13492-PD 278..432 162..632 169 33.9 Plus
CG13492-PD 2979 CG13492-PD 2638..2790 162..638 162 29.9 Plus
CG15773-PB 319 CG15773-PB 33..177 162..632 160 29.4 Plus
CG4363-PA 199 CG4363-PA 24..180 153..632 155 25.5 Plus
CG13492-PD 2979 CG13492-PD 1120..1271 162..632 154 26.9 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 17:20:51
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 8458489..8459170 951..270 3410 100 Minus
X 23542271 X 8459224..8459383 270..111 800 100 Minus
X 23542271 X 8460765..8460876 112..1 560 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 23:07:40
Subject Length Description Subject Range Query Range Score Percent Strand
X 23527363 X 8466587..8467268 951..270 3410 100 Minus
X 23527363 X 8467322..8467481 270..111 800 100 Minus
X 23527363 X 8468863..8468974 112..1 560 100 Minus
Blast to na_te.dros performed on 2014-11-27 17:20:52 has no hits.

LP18071.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2014-11-27 18:09:37 Download gff for LP18071.complete
Subject Subject Range Query Range Percent Splice Strand
chrX 8352544..8352654 1..111 100   Minus
chrX 8351001..8351159 112..270 100 <- Minus
chrX 8350271..8350946 271..946 99 <- Minus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-02-18 13:31:29 Download gff for LP18071.complete
Subject Subject Range Query Range Percent Splice Strand
CG15347-RB 1..690 54..743 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-03 20:51:21 Download gff for LP18071.complete
Subject Subject Range Query Range Percent Splice Strand
CG15347-RB 1..690 54..743 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 18:09:37 Download gff for LP18071.complete
Subject Subject Range Query Range Percent Splice Strand
CG15347-RB 1..690 54..743 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-02-18 13:31:27 Download gff for LP18071.complete
Subject Subject Range Query Range Percent Splice Strand
CG15347-RB 19..964 1..946 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-03 20:51:21 Download gff for LP18071.complete
Subject Subject Range Query Range Percent Splice Strand
CG15347-RB 23..968 1..946 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 18:09:37 Download gff for LP18071.complete
Subject Subject Range Query Range Percent Splice Strand
CG15347-RB 23..968 1..946 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 18:09:37 Download gff for LP18071.complete
Subject Subject Range Query Range Percent Splice Strand
X 8460766..8460876 1..111 100   Minus
X 8459224..8459382 112..270 100 <- Minus
X 8458494..8459169 271..946 100 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-03 20:51:21 Download gff for LP18071.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 8354799..8354909 1..111 100   Minus
arm_X 8353257..8353415 112..270 100 <- Minus
arm_X 8352527..8353202 271..946 100 <- Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 19:59:31 Download gff for LP18071.complete
Subject Subject Range Query Range Percent Splice Strand
X 8468864..8468974 1..111 100   Minus
X 8467322..8467480 112..270 100 <- Minus
X 8466592..8467267 271..946 100 <- Minus

LP18071.pep Sequence

Translation from 53 to 742

> LP18071.pep
MKFYLLVIAALSFLAYISCGMTQSKRSVPLAQFADGCIQCNSKDNERCAT
DPLSLLNRNCSDGSSNCYSRVLDGYTIRGCAVDLDNATRNSCNNELLCQL
CTYSEGCNRNTFPLSRLMCLQCTGNSTSSSCATETYVSAKICPLYKFGDK
CYIRNSNRTVDGSFQRGCLTSANARKQCVKDGNCYTCEGRGCNFLLANDT
NIPLARDSGAQLIISMTLLISGLVAAWRL*

LP18071.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2014-11-28 08:39:27
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF22583-PA 214 GF22583-PA 1..214 1..229 886 73.8 Plus
Blast to dere-all-translation-r1.3.fasta performed 2014-11-28 08:39:28
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG19047-PA 214 GG19047-PA 1..214 1..229 956 79.9 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2014-11-28 08:39:29
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH12232-PA 213 GH12232-PA 1..191 1..207 656 60.4 Plus
Dgri\GH20775-PA 2920 GH20775-PA 2741..2917 37..222 160 30.2 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 08:39:25
Subject Length Description Subject Range Query Range Score Percent Strand
CG15347-PB 229 CG15347-PB 1..229 1..229 1231 100 Plus
CG15347-PA 214 CG15347-PA 1..214 1..229 1132 93.4 Plus
CG13492-PD 2979 CG13492-PD 2799..2975 37..226 204 26.9 Plus
CG13492-PD 2979 CG13492-PD 1538..1695 37..193 184 31.7 Plus
CG13492-PD 2979 CG13492-PD 2372..2540 27..198 180 31.5 Plus
CG13492-PD 2979 CG13492-PD 1956..2114 27..193 177 33.1 Plus
CG13492-PD 2979 CG13492-PD 698..849 37..193 176 31.1 Plus
CG13492-PD 2979 CG13492-PD 278..432 37..193 169 33.9 Plus
CG13492-PD 2979 CG13492-PD 2638..2790 37..195 162 29.9 Plus
CG15773-PB 319 CG15773-PB 33..177 37..193 160 29.4 Plus
CG4363-PA 199 CG4363-PA 24..180 34..193 155 25.5 Plus
CG13492-PD 2979 CG13492-PD 1120..1271 37..193 154 26.9 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2014-11-28 08:39:31
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI15766-PA 214 GI15766-PA 1..206 1..221 660 56.6 Plus
Dmoj\GI20859-PA 2960 GI20859-PA 2781..2956 37..221 158 30.5 Plus
Blast to dper-all-translation-r1.3.fasta performed 2014-11-28 08:39:32
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL20247-PA 217 GL20247-PA 1..217 1..229 796 66.4 Plus
Dper\GL17513-PA 2988 GL17513-PA 2807..2988 35..228 172 30.3 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2014-11-28 08:39:34
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA13659-PA 217 GA13659-PA 1..217 1..229 800 67.2 Plus
Dpse\GA12325-PA 2988 GA12325-PA 2807..2988 35..228 172 30.3 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2014-11-28 08:39:35
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM21334-PA 214 GM21334-PA 1..214 1..229 1010 86 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2014-11-28 08:39:37
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD16112-PA 214 GD16112-PA 1..214 1..229 1025 87.3 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2014-11-28 08:39:38
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ18623-PA 214 GJ18623-PA 1..206 1..221 728 62 Plus
Dvir\GJ20594-PA 2976 GJ20594-PA 2795..2976 34..229 173 32.7 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2014-11-28 08:39:40
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK19986-PA 214 GK19986-PA 1..214 1..229 733 61.1 Plus
Dwil\GK15649-PA 2984 GK15649-PA 2801..2978 35..224 165 30.4 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2014-11-28 08:39:41
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE17452-PA 214 GE17452-PA 1..214 1..229 1001 84.3 Plus
Dyak\GE13674-PA 2979 GE13674-PA 2799..2949 37..195 149 30.6 Plus

LP18071.hyp Sequence

Translation from 53 to 742

> LP18071.hyp
MKFYLLVIAALSFLAYISCGMTQSKRSVPLAQFADGCIQCNSKDNERCAT
DPLSLLNRNCSDGSSNCYSRVLDGYTIRGCAVDLDNATRNSCNNELLCQL
CTYSEGCNRNTFPLSRLMCLQCTGNSTSSSCATETYVSAKICPLYKFGDK
CYIRNSNRTVDGSFQRGCLTSANARKQCVKDGNCYTCEGRGCNFLLANDT
NIPLARDSGAQLIISMTLLISGLVAAWRL*

LP18071.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:58:34
Subject Length Description Subject Range Query Range Score Percent Strand
CG15347-PB 229 CG15347-PB 1..229 1..229 1231 100 Plus
CG15347-PA 214 CG15347-PA 1..214 1..229 1132 93.4 Plus
CG13492-PD 2979 CG13492-PD 2799..2975 37..226 204 26.9 Plus
CG13492-PD 2979 CG13492-PD 1538..1695 37..193 184 31.7 Plus
CG13492-PD 2979 CG13492-PD 2372..2540 27..198 180 31.5 Plus
CG13492-PD 2979 CG13492-PD 1956..2114 27..193 177 33.1 Plus
CG13492-PD 2979 CG13492-PD 698..849 37..193 176 31.1 Plus
CG13492-PD 2979 CG13492-PD 278..432 37..193 169 33.9 Plus
CG13492-PD 2979 CG13492-PD 2638..2790 37..195 162 29.9 Plus
CG15773-PB 319 CG15773-PB 33..177 37..193 160 29.4 Plus
CG4363-PA 199 CG4363-PA 24..180 34..193 155 25.5 Plus
CG13492-PD 2979 CG13492-PD 1120..1271 37..193 154 26.9 Plus