Clone LP18603 Report

Search the DGRC for LP18603

Clone and Library Details

Library:LP
Tissue Source:Drosophila melanogaster larval-early pupal
Created by:Ling Hong
Date Registered:1998-06-11
Comments:Sized fractionated cDNAs were directly ligated into pOT2. Plasmid cDNA library.
Original Plate Number:186
Well:3
Vector:pOT2
Associated Gene/TranscriptRm62-RE
Protein status:LP18603.pep: gold
Sequenced Size:2902

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
Rm62-RE 2009-06-22 Replacement based on scoring

Clone Sequence Records

LP18603.complete Sequence

2902 bp assembled on 2009-09-04

GenBank Submission: BT099694.1

> LP18603.complete
CGGCACTTTCGCTTCTTCTTCTTCGCTCTGCACCGAACAACGACAACAGT
TCCACGGGAGTCGCAGGAATCGTGAGACAATACTGTTCCCAAGCACATAT
AGTAGTCTCCAAGCTCAGTCGCAGCGTGCGTTTCGAGACAGCTCGAAACC
AGATTCAGACGACTACGTAGATTCCATCCCGAAAGCAGAGCAGCGGACGA
GGACGAGGAAATCGCTTTTCAACGATCCCGACGAAAGAACTGAGGAAATC
AAAATTGAAGGAGTAATTTTATTGCGGTTGTAGCACAGCACAACTCCCAT
GTCAGCTGTTTAGCAGCGTCGAAAGAAATCGAAAAGCGAAGACTTACCTT
CCAAGCCAAGTCGCAGTTGAAATCCAAGTCCCAACTGGCAGACGTCTAGA
AACGGCAGCATGCGAGCAAAGGCACCACACGATCGCGACTTTGGTCACAG
TGGACGTGGCGGTCGCGGAGGCGATCGAGGCGGCGATGATCGGCGAGGAG
GCGGCGGCGGAGGCAATCGCTTCGGTGGCGGCGGTGGCGGTGGCGATTAC
CACGGCATAAGGAATGGACGCGTCGAGAAGCGACGCGATGACCGCGGAGG
CGGCAACCGATTTGGAGGTGGTGGTGGATTCGGGGATCGCCGAGGAGGAG
GTGGCGGCGGCAGCCAAGACCTCCCCATGCGTCCGGTCGACTTCTCCAAC
CTGGCTCCCTTCAAGAAGAACTTTTACCAGGAGCACCCTAACGTAGCAAA
CCGATCGCCCTACGAAGTTCAGAGGTATCGCGAAGAGCAGGAGATCACCG
TGCGCGGACAGGTGCCGAACCCCATCCAGGACTTCTCCGAGGTCCATCTG
CCCGACTACGTCATGAAGGAGATCCGCCGACAGGGCTACAAGGCCCCCAC
CGCTATCCAAGCGCAGGGCTGGCCTATCGCCATGAGTGGCTCGAACTTCG
TCGGCATTGCCAAGACGGGATCCGGAAAGACCCTGGGCTACATCCTGCCC
GCTATTGTCCACATCAACAACCAGCAGCCGCTGCAGAGGGGCGACGGACC
TATCGCCCTCGTGCTGGCCCCCACTCGGGAGCTGGCCCAACAGATCCAGC
AGGTGGCCACCGAATTCGGTTCCTCGTCGTATGTTCGCAACACCTGCGTC
TTCGGCGGCGCCCCGAAGGGCGGCCAAATGCGGGATCTGCAGCGCGGCTG
CGAGATCGTCATTGCCACACCCGGACGTCTTATTGATTTCCTCTCCGCCG
GCTCTACTAACCTGAAGCGTTGCACCTACTTGGTGCTGGACGAGGCCGAT
CGCATGTTAGACATGGGCTTCGAGCCCCAGATCAGAAAGATCGTCTCACA
GATCCGGCCCGACCGACAGACGCTCATGTGGAGCGCTACCTGGCCCAAGG
AGGTCAAGCAGCTTGCCGAGGACTTTTTGGGCAACTACATCCAGATCAAC
ATTGGATCGCTGGAGCTGTCCGCCAATCACAACATCCGCCAGGTGGTGGA
CGTTTGTGACGAGTTCAGCAAGGAGGAGAAATTGAAGACCCTCCTGTCAG
ACATCTACGACACCAGCGAGAGCCCCGGCAAGATTATCATATTCGTGGAG
ACAAAGCGACGCGTGGACAACCTGGTGCGCTTCATCCGCAGCTTCGGAGT
CCGTTGTGGAGCTATTCACGGTGACAAGTCGCAATCAGAACGAGACTTTG
TGCTCCGTGAGTTCCGCTCGGGCAAGTCCAACATTCTGGTGGCCACCGAT
GTGGCGGCCCGTGGACTAGACGTGGACGGCATCAAGTATGTCATCAACTT
TGACTACCCGCAAAACAGCGAGGACTACATCCATCGCATCGGTCGCACAG
GACGATCCAACACAAAGGGCACCTCTTTCGCCTTCTTCACCAAGAACAAT
GCCAAGCAAGCCAAGGCGCTGGTCGACGTACTCCGAGAAGCTAATCAGGA
AATCAATCCTGCCCTGGAAAATCTGGCCCGCAACTCGCGCTACGACGGTG
GCGGCGGACGCTCCCGTTATGGAGGCGGTGGCGGCGGCGGTCGCTTCGGC
GGCGGCGGCTTCAAGAAGGGCAGCCTGAGCAACGGACGAGGCTTCGGAGG
AGGCGGCGGCGGCGGCGGCGAAGGCAGACACTCGCGCTTCGACTAGATCG
CGGACAATTAGATGAGCAGTAAAAGAAGCTATAGGAACAGGAGATTTCAG
TAGCTAAACTAAACCGCACTAGGTCCTAAGTTAAATTAAGTTCATAGCTT
AAGTTAAGATTTCGTACTACTTTCACCAAACCGCTGACGGTTATTTTTAG
ACTTAAATTCAGACTCCCTGATTAATGAAACACTACAAAATGCGAGCTAT
TTGAACATAGCGAATTTATGTTTAAATGATTTGTAAGTTATTTGACGCTG
GCCGCGAGGTCGGTACAACACAATCCAATTGAGAACATCAAAAACACTTT
ACTTAAACGCAAAAACCAATTTTCAAATATCATGTGATAATTTCTTAATT
TAACGCAACGTATCACTAAACTAAAAGCAAAGGAAATCGTAGCGCGAGGA
GTACGTTGATGTAGTGGAGGAAAAGGAGGAAGTAAGGATCATTCCCGTCT
GTCCCGTTTTGATGACAATGAACAAAGGCTGACCTGACGAGCGACCTTTG
TTTGATAAATAAATTCTTCAAATTACTTTTGGAAAATTAACTTTTGGATA
CCTTTTATGGCTCAACACGAGAACAAGAATGTGTAAAGCAAACAAAGCAA
ACGGGAAATCACATTAACTACTGACACTAAATACAAAAGAAAAACAAACT
GTATGTACAAGATGAGAAGTTCTCTTTCAATTTAATTTTTCGGAAAAAAA
TAAAGTTTGTGTATACCTATTACAACCTAAACCAAAAAAAAAAAAAAAAA
AA

LP18603.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 16:37:56
Subject Length Description Subject Range Query Range Score Percent Strand
Rm62.a 2990 Rm62.a 65..2956 1..2892 14430 99.9 Plus
Rm62-RE 3236 Rm62-RE 574..3202 264..2892 13100 99.8 Plus
Rm62.b 3010 Rm62.b 348..2976 264..2892 13100 99.8 Plus
Rm62-RE 3236 Rm62-RE 299..568 1..270 1350 100 Plus
Rm62.b 3010 Rm62.b 73..342 1..270 1350 100 Plus
Blast to d_melanogaster_OreR.fa performed 2014-11-27 10:34:51
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 1829643..1830752 1530..421 5550 100 Minus
chr3R 27901430 chr3R 1826040..1826979 2883..1944 4700 100 Minus
chr3R 27901430 chr3R 1833663..1833929 267..1 1335 100 Minus
chr3R 27901430 chr3R 1829299..1829537 1769..1531 1195 100 Minus
chr3R 27901430 chr3R 1827171..1827353 1949..1767 915 100 Minus
chr3R 27901430 chr3R 1831575..1831732 421..264 775 99.4 Minus
chrX 22417052 chrX 7820818..7821117 1492..1193 420 76 Minus
chrX 22417052 chrX 7821218..7821420 1098..896 295 76.4 Minus
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 10:34:47
Subject Length Description Subject Range Query Range Score Percent Strand
Rm62-RI 1737 CG10279-PI 1..1737 410..2146 8685 100 Plus
Rm62-RE 1737 CG10279-PE 1..1737 410..2146 8685 100 Plus
Rm62-RA 2160 CG10279-PA 428..2160 414..2146 8635 99.9 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 19:58:01 has no hits.
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 10:34:46
Subject Length Description Subject Range Query Range Score Percent Strand
Rm62-RI 3153 CG10279-RI 271..3153 1..2883 14415 100 Plus
Rm62-RE 3160 CG10279-RE 271..3160 1..2878 14235 99.6 Plus
Rm62-RH 2760 CG10279-RH 296..2760 414..2878 12295 99.9 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 10:34:50
Subject Length Description Subject Range Query Range Score Percent Strand
Rm62-PH 575 CG10279-PH 82..575 662..2143 2308 100 Plus
Rm62-PI 578 CG10279-PI 85..578 662..2143 2308 100 Plus
Rm62-PF 578 CG10279-PF 85..578 662..2143 2308 100 Plus
Rm62-PE 578 CG10279-PE 85..578 662..2143 2308 100 Plus
Rm62-PA 719 CG10279-PA 226..719 662..2143 2308 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 10:34:44
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 6004017..6005126 1530..421 5550 100 Minus
3R 32079331 3R 6000417..6001365 2892..1944 4715 99.8 Minus
3R 32079331 3R 6008037..6008303 267..1 1335 100 Minus
3R 32079331 3R 6003673..6003911 1769..1531 1195 100 Minus
3R 32079331 3R 6001557..6001739 1949..1767 915 100 Minus
3R 32079331 3R 6005949..6006106 421..264 775 99.4 Minus
X 23542271 X 7928923..7929222 1492..1193 420 76 Minus
X 23542271 X 7929323..7929525 1098..896 295 76.4 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 18:34:57
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 5744848..5745957 1530..421 5550 100 Minus
3R 31820162 3R 5741248..5742196 2892..1944 4715 99.7 Minus
3R 31820162 3R 5748868..5749134 267..1 1335 100 Minus
3R 31820162 3R 5744504..5744742 1769..1531 1195 100 Minus
3R 31820162 3R 5742388..5742570 1949..1767 915 100 Minus
3R 31820162 3R 5746780..5746937 421..264 775 99.3 Minus
X 23527363 X 7937021..7937257 1492..1256 390 77.6 Minus
3L 28103327 3L 6947214..6947373 1422..1263 380 82.5 Minus
3L 28103327 3L 6947527..6947677 1109..959 260 78.1 Minus
3L 28103327 3L 6947123..6947203 1513..1433 180 81.4 Minus
X 23527363 X 7937421..7937479 1098..1040 175 86.4 Minus
3L 28103327 3L 6947393..6947454 1243..1182 145 82.2 Minus
X 23527363 X 7936512..7936546 1755..1721 145 94.2 Minus
Blast to na_te.dros performed on 2014-11-27 10:34:45 has no hits.

LP18603.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2014-11-27 11:45:47 Download gff for LP18603.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 1833663..1833929 1..267 100   Minus
chr3R 1831576..1831728 268..420 100 <- Minus
chr3R 1830718..1830752 421..455 100 <- Minus
chr3R 1829643..1830627 546..1530 100 == Minus
chr3R 1829299..1829537 1531..1769 100 <- Minus
chr3R 1827172..1827350 1770..1948 100 <- Minus
chr3R 1826040..1826974 1949..2883 96 <- Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2009-10-19 17:49:39 Download gff for LP18603.complete
Subject Subject Range Query Range Percent Splice Strand
Rm62-RE 1..1737 410..2146 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 14:09:05 Download gff for LP18603.complete
Subject Subject Range Query Range Percent Splice Strand
Rm62-RI 1..1737 410..2146 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 16:15:17 Download gff for LP18603.complete
Subject Subject Range Query Range Percent Splice Strand
Rm62-RE 1..1737 410..2146 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 11:45:47 Download gff for LP18603.complete
Subject Subject Range Query Range Percent Splice Strand
Rm62-RE 1..1737 410..2146 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2009-09-04 09:13:35 Download gff for LP18603.complete
Subject Subject Range Query Range Percent Splice Strand
Rm62-RE 4..2898 1..2883 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 14:09:05 Download gff for LP18603.complete
Subject Subject Range Query Range Percent Splice Strand
Rm62-RI 271..3148 1..2878 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 16:15:17 Download gff for LP18603.complete
Subject Subject Range Query Range Percent Splice Strand
Rm62-RI 271..3153 1..2883 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 11:45:47 Download gff for LP18603.complete
Subject Subject Range Query Range Percent Splice Strand
Rm62-RI 271..3153 1..2883 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 11:45:47 Download gff for LP18603.complete
Subject Subject Range Query Range Percent Splice Strand
3R 6008037..6008303 1..267 100   Minus
3R 6005950..6006102 268..420 100 <- Minus
3R 6004017..6005126 421..1530 100 <- Minus
3R 6003673..6003911 1531..1769 100 <- Minus
3R 6001558..6001736 1770..1948 100 <- Minus
3R 6000426..6001360 1949..2883 100 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 16:15:17 Download gff for LP18603.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 1833759..1834025 1..267 100   Minus
arm_3R 1831672..1831824 268..420 100 <- Minus
arm_3R 1829739..1830848 421..1530 100 <- Minus
arm_3R 1829395..1829633 1531..1769 100 <- Minus
arm_3R 1827280..1827458 1770..1948 100 <- Minus
arm_3R 1826148..1827082 1949..2883 100 <- Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 12:01:02 Download gff for LP18603.complete
Subject Subject Range Query Range Percent Splice Strand
3R 5748868..5749134 1..267 100   Minus
3R 5746781..5746933 268..420 100 <- Minus
3R 5744848..5745957 421..1530 100 <- Minus
3R 5744504..5744742 1531..1769 100 <- Minus
3R 5742389..5742567 1770..1948 100 <- Minus
3R 5741257..5742191 1949..2883 100 <- Minus

LP18603.pep Sequence

Translation from 409 to 2145

> LP18603.pep
MRAKAPHDRDFGHSGRGGRGGDRGGDDRRGGGGGGNRFGGGGGGGDYHGI
RNGRVEKRRDDRGGGNRFGGGGGFGDRRGGGGGGSQDLPMRPVDFSNLAP
FKKNFYQEHPNVANRSPYEVQRYREEQEITVRGQVPNPIQDFSEVHLPDY
VMKEIRRQGYKAPTAIQAQGWPIAMSGSNFVGIAKTGSGKTLGYILPAIV
HINNQQPLQRGDGPIALVLAPTRELAQQIQQVATEFGSSSYVRNTCVFGG
APKGGQMRDLQRGCEIVIATPGRLIDFLSAGSTNLKRCTYLVLDEADRML
DMGFEPQIRKIVSQIRPDRQTLMWSATWPKEVKQLAEDFLGNYIQINIGS
LELSANHNIRQVVDVCDEFSKEEKLKTLLSDIYDTSESPGKIIIFVETKR
RVDNLVRFIRSFGVRCGAIHGDKSQSERDFVLREFRSGKSNILVATDVAA
RGLDVDGIKYVINFDYPQNSEDYIHRIGRTGRSNTKGTSFAFFTKNNAKQ
AKALVDVLREANQEINPALENLARNSRYDGGGGRSRYGGGGGGGRFGGGG
FKKGSLSNGRGFGGGGGGGGEGRHSRFD*

LP18603.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2014-11-28 04:51:30
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF18634-PA 704 GF18634-PA 128..704 5..578 2379 89.5 Plus
Dana\GF24750-PA 613 GF24750-PA 64..502 90..526 1756 73.8 Plus
Dana\GF10884-PA 822 GF10884-PA 86..538 74..529 1612 67.4 Plus
Dana\GF20995-PA 996 GF20995-PA 195..642 90..531 1452 60.1 Plus
Dana\GF16725-PA 693 GF16725-PA 209..647 95..523 1018 45.3 Plus
Blast to dere-all-translation-r1.3.fasta performed 2014-11-28 04:51:32
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG10666-PA 720 GG10666-PA 142..670 5..529 2440 97.7 Plus
Dere\GG15018-PA 824 GG15018-PA 84..544 66..529 1615 66.7 Plus
Dere\GG17597-PA 955 GG17597-PA 195..656 95..549 1483 60.6 Plus
Dere\GG23261-PA 709 GG23261-PA 161..670 20..524 964 41.9 Plus
Dere\GG17877-PA 1222 GG17877-PA 458..889 93..522 894 42.6 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2014-11-28 04:51:35
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH14289-PA 746 GH14289-PA 163..688 5..529 2353 91.9 Plus
Dgri\GH22580-PA 793 GH22580-PA 102..547 97..543 1587 67.4 Plus
Dgri\GH24775-PA 977 GH24775-PA 193..628 95..524 1472 62.2 Plus
Dgri\GH18325-PA 684 GH18325-PA 209..647 95..523 928 43.2 Plus
Dgri\GH17046-PA 811 GH17046-PA 238..726 89..576 888 39.7 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 04:51:27
Subject Length Description Subject Range Query Range Score Percent Strand
Rm62-PI 578 CG10279-PI 1..578 1..578 3060 100 Plus
Rm62-PE 578 CG10279-PE 1..578 1..578 3060 100 Plus
Rm62-PF 578 CG10279-PF 1..578 1..578 3043 99.5 Plus
Rm62-PB 578 CG10279-PB 1..578 1..578 3043 99.5 Plus
Rm62-PC 578 CG10279-PC 1..578 1..578 3043 99.5 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2014-11-28 04:51:37
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI23184-PA 724 GI23184-PA 147..665 5..529 2407 91.1 Plus
Dmoj\GI12524-PA 602 GI12524-PA 28..494 50..525 1781 71.4 Plus
Dmoj\GI12369-PA 794 GI12369-PA 99..543 97..543 1596 67.9 Plus
Dmoj\GI14822-PA 963 GI14822-PA 190..624 95..524 1484 63.2 Plus
Dmoj\GI23306-PA 702 GI23306-PA 134..668 21..523 936 39.8 Plus
Blast to dper-all-translation-r1.3.fasta performed 2014-11-28 04:51:40
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL23489-PA 649 GL23489-PA 148..594 83..529 2283 95.1 Plus
Dper\GL16096-PA 554 GL16096-PA 9..551 48..561 1713 62.7 Plus
Dper\GL13229-PA 455 GL13229-PA 56..453 64..453 1356 67.2 Plus
Dper\GL15249-PA 688 GL15249-PA 1..376 155..525 1318 64.1 Plus
Dper\GL24257-PA 703 GL24257-PA 243..650 95..524 902 41 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2014-11-28 04:51:42
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA10214-PA 738 GA10214-PA 151..685 5..529 2309 89 Plus
Dpse\GA28491-PA 537 GA28491-PA 9..534 48..561 1775 65.8 Plus
Dpse\GA28589-PA 799 GA28589-PA 56..523 64..523 1620 66.8 Plus
Dpse\GA10556-PA 939 GA10556-PA 192..628 95..525 1452 61.6 Plus
Dpse\GA20653-PB 692 GA20653-PB 200..639 95..524 962 43.6 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2014-11-28 04:51:45
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM10578-PA 724 GM10578-PA 146..724 5..578 2450 98.1 Plus
Dsec\GM11962-PA 946 GM11962-PA 192..653 95..549 1468 60 Plus
Dsec\GM13808-PA 672 GM13808-PA 97..399 212..529 1170 69.5 Plus
Dsec\GM23704-PA 699 GM23704-PA 216..655 95..524 994 45.3 Plus
Dsec\GM20179-PA 1214 GM20179-PA 450..881 93..522 891 42.1 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2014-11-28 04:51:48
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD13105-PA 814 GD13105-PA 84..541 66..529 1610 66.9 Plus
Dsim\GD16140-PA 800 GD16140-PA 192..653 95..549 1465 60 Plus
Dsim\GD18514-PA 713 GD18514-PA 230..669 95..524 1000 44.8 Plus
Dsim\GD17585-PA 786 GD17585-PA 212..662 89..534 864 41.1 Plus
Dsim\GD15121-PA 163 GD15121-PA 1..155 299..453 826 100 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2014-11-28 04:51:52
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ14499-PA 733 GJ14499-PA 147..671 5..529 2341 89.1 Plus
Dvir\GJ16043-PA 605 GJ16043-PA 40..507 50..526 1705 68.1 Plus
Dvir\GJ12262-PA 778 GJ12262-PA 18..542 31..542 1596 62 Plus
Dvir\GJ19487-PA 953 GJ19487-PA 191..627 95..524 1470 62.2 Plus
Dvir\GJ24162-PA 710 GJ24162-PA 241..680 95..524 953 43 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2014-11-28 04:51:55
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK14214-PA 745 GK14214-PA 165..693 5..529 2396 90 Plus
Dwil\GK12550-PA 800 GK12550-PA 90..524 97..536 1613 69.4 Plus
Dwil\GK16276-PA 950 GK16276-PA 195..632 95..525 1468 61.2 Plus
Dwil\GK14378-PA 683 GK14378-PA 204..642 95..523 954 44.3 Plus
Dwil\GK20023-PA 1234 GK20023-PA 478..895 93..508 879 43 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2014-11-28 04:51:58
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE24123-PA 719 GE24123-PA 142..672 5..529 2416 96.6 Plus
Dyak\GE20460-PA 818 GE20460-PA 86..543 73..529 1615 66.7 Plus
Dyak\GE17497-PA 962 GE17497-PA 193..654 95..549 1440 59.5 Plus
Dyak\GE25850-PA 688 GE25850-PA 136..649 14..524 972 41.8 Plus
Dyak\GE17181-PA 1215 GE17181-PA 451..882 93..522 893 42.6 Plus

LP18603.hyp Sequence

Translation from 409 to 2145

> LP18603.hyp
MRAKAPHDRDFGHSGRGGRGGDRGGDDRRGGGGGGNRFGGGGGGGDYHGI
RNGRVEKRRDDRGGGNRFGGGGGFGDRRGGGGGGSQDLPMRPVDFSNLAP
FKKNFYQEHPNVANRSPYEVQRYREEQEITVRGQVPNPIQDFSEVHLPDY
VMKEIRRQGYKAPTAIQAQGWPIAMSGSNFVGIAKTGSGKTLGYILPAIV
HINNQQPLQRGDGPIALVLAPTRELAQQIQQVATEFGSSSYVRNTCVFGG
APKGGQMRDLQRGCEIVIATPGRLIDFLSAGSTNLKRCTYLVLDEADRML
DMGFEPQIRKIVSQIRPDRQTLMWSATWPKEVKQLAEDFLGNYIQINIGS
LELSANHNIRQVVDVCDEFSKEEKLKTLLSDIYDTSESPGKIIIFVETKR
RVDNLVRFIRSFGVRCGAIHGDKSQSERDFVLREFRSGKSNILVATDVAA
RGLDVDGIKYVINFDYPQNSEDYIHRIGRTGRSNTKGTSFAFFTKNNAKQ
AKALVDVLREANQEINPALENLARNSRYDGGGGRSRYGGGGGGGRFGGGG
FKKGSLSNGRGFGGGGGGGGEGRHSRFD*

LP18603.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:22:04
Subject Length Description Subject Range Query Range Score Percent Strand
Rm62-PI 578 CG10279-PI 1..578 1..578 3060 100 Plus
Rm62-PE 578 CG10279-PE 1..578 1..578 3060 100 Plus
Rm62-PF 578 CG10279-PF 1..578 1..578 3043 99.5 Plus
Rm62-PB 578 CG10279-PB 1..578 1..578 3043 99.5 Plus
Rm62-PC 578 CG10279-PC 1..578 1..578 3043 99.5 Plus