Clone LP21778 Report

Search the DGRC for LP21778

Clone and Library Details

Library:LP
Tissue Source:Drosophila melanogaster larval-early pupal
Created by:Ling Hong
Date Registered:1998-06-11
Comments:Sized fractionated cDNAs were directly ligated into pOT2. Plasmid cDNA library.
Original Plate Number:217
Well:78
Vector:pOT2
Associated Gene/TranscriptCG16758-RE
Protein status:LP21778.pep: gold
Sequenced Size:1182

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG16758-RE 2010-11-11 Gleaning Pick By Joe Carlson

Clone Sequence Records

LP21778.complete Sequence

1182 bp assembled on 2010-12-09

GenBank Submission: BT125825.1

> LP21778.complete
TTCGTTCGATACCCAAAAACTATATCCCTCGGCCCCAAAATGTGTAACGC
CAATTGCTGTTCGAATCCCAAAGGCAAGGCTGGCACCAAAACCGCCATCA
ATAATACAAATTGGCCAGATATCATACCAACTCCAGAAAGTCTGCTGTAT
CCCTATGAGGTCATCGAGGAGATCGCCGACTTCATTACCAAGGGGTCCGG
CATGCGCCCCAAGATCGGCATCATCTGCGGCTCTGGGCTAGGCTCATTGG
CCGATATGATCCAGGACCCGAAGATCTTCGAGTATGAGAAGATCCCCAAC
TTCCCGGTATCTACAGTTGAGGGCCATGCCGGACGACTGGTGGTCGGCAC
ACTCGAGGGCGCCACTGTGATGGCGATGCAGGGCAGGTTCCACTTCTACG
AGGGCTATCCGCTGGCCAAGTGCTCAATGCCGGTTCGCGTGATGAAGCTG
TGCGGTGTGGAATACCTGTTCGCCACCAATGCGGCTGGTGGAATCAATCC
ACGGTTCGCGGTGGGCGACATCATGCTGATGCATGACCATGTCAACATGC
TGGGCTTTGCCGGAAATTCTCCGCTCCAGGGACCCAATGACCCACGCTTC
GGACCCCGCTTTCCCGCCCTGGTGAACTCGTACAACAAGGACCTAATCAA
CAAGGCCATCGAGATCGCCAAGGCCATGGGCATAGAGTCCAACATTCACG
TCGGCGTATACTCCTGTCTGGGTGGTCCCAACTACGAGACCATCGCCGAG
CTGAAGGCCCTGCGCATGATGGGCGTGGATGCGGTGGGCATGTCCACCGT
ACATGAGGTCATCACTGCACGGCACTGCGACATGAAGGTATTCGCCTTCA
GCCTCATCACAAATAAGTGCGCCACCGAGTACAGCGATAAGAAGGACGAT
GAGGCCAACCACGATGAGGTTATGGCTGTGGCCAAGAACAGGCAAAAGGC
CTGCTGCGAACTGGTCTCCCGACTCATCCGGGAAATCCACTTGGCATCCG
CTTAAGTAGCGAAGCGAAGAAGTAGCGTTGGATTCTAAATTTAAAAATAG
TTAATTCTCTGAGCTCGCATCTAAGACTCACATGACACGGATTGTCCAAA
ATCTTACAGTATAGGCCTAGGGAATAGTTTAACTAAATTATGTAAAATAA
ACTAGCTATATCACAAAAAAAAAAAAAAAAAA

LP21778.complete Blast Records

Blast to d_melanogaster_OreR.fa performed 2014-11-27 16:33:34
Subject Length Description Subject Range Query Range Score Percent Strand
chr3L 24539361 chr3L 2499201..2499974 920..147 3870 100 Minus
chr3L 24539361 chr3L 2498890..2499137 1164..917 1240 100 Minus
chr3L 24539361 chr3L 2501900..2502048 149..1 745 100 Minus
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 16:33:30
Subject Length Description Subject Range Query Range Score Percent Strand
CG16758-RE 966 CG16758-PE 1..966 40..1005 4830 100 Plus
CG16758-RG 1119 CG16758-PG 235..1119 121..1005 4365 99.5 Plus
CG16758-RF 987 CG16758-PF 103..987 121..1005 4365 99.5 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 16:33:28
Subject Length Description Subject Range Query Range Score Percent Strand
CG16758-RE 1449 CG16758-RE 280..1443 1..1164 5820 100 Plus
CG16758-RG 1617 CG16758-RG 568..1611 121..1164 5160 99.6 Plus
CG16758-RF 1245 CG16758-RF 196..1239 121..1164 5160 99.6 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 16:33:32
Subject Length Description Subject Range Query Range Score Percent Strand
CG16758-PE 321 CG16758-PE 1..321 40..1002 1626 100 Plus
CG16758-PG 372 CG16758-PG 38..372 19..1002 1495 90.5 Plus
CG16758-PF 328 CG16758-PF 1..328 40..1002 1488 91.8 Plus
CG16758-PH 396 CG16758-PH 38..396 19..1002 1460 84.5 Plus
CG16758-PD 329 CG16758-PD 3..329 31..1002 1436 90.9 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 16:33:27
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 2499689..2500462 920..147 3870 100 Minus
3L 28110227 3L 2499376..2499625 1166..917 1250 100 Minus
3L 28110227 3L 2502388..2502536 149..1 745 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 23:03:46
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28103327 3L 2499689..2500462 920..147 3870 100 Minus
3L 28103327 3L 2499376..2499625 1166..917 1250 100 Minus
3L 28103327 3L 2502388..2502536 149..1 745 100 Minus
Blast to na_te.dros performed on 2014-11-27 16:33:28 has no hits.

LP21778.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2014-11-27 17:53:32 Download gff for LP21778.complete
Subject Subject Range Query Range Percent Splice Strand
chr3L 2501903..2502048 1..146 100   Minus
chr3L 2499203..2499974 147..918 100 <- Minus
chr3L 2498890..2499135 919..1164 100 <- Minus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2010-12-10 09:34:18 Download gff for LP21778.complete
Subject Subject Range Query Range Percent Splice Strand
CG16758-RE 1..966 40..1005 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-03 20:34:03 Download gff for LP21778.complete
Subject Subject Range Query Range Percent Splice Strand
CG16758-RE 1..966 40..1005 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 17:53:32 Download gff for LP21778.complete
Subject Subject Range Query Range Percent Splice Strand
CG16758-RE 1..966 40..1005 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2010-12-10 09:34:18 Download gff for LP21778.complete
Subject Subject Range Query Range Percent Splice Strand
CG16758-RE 280..1443 1..1164 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-03 20:34:03 Download gff for LP21778.complete
Subject Subject Range Query Range Percent Splice Strand
CG16758-RE 280..1443 1..1164 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 17:53:32 Download gff for LP21778.complete
Subject Subject Range Query Range Percent Splice Strand
CG16758-RE 280..1443 1..1164 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 17:53:32 Download gff for LP21778.complete
Subject Subject Range Query Range Percent Splice Strand
3L 2502391..2502536 1..146 100   Minus
3L 2499691..2500462 147..918 100 <- Minus
3L 2499378..2499623 919..1164 100 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-03 20:34:03 Download gff for LP21778.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 2502391..2502536 1..146 100   Minus
arm_3L 2499691..2500462 147..918 100 <- Minus
arm_3L 2499378..2499623 919..1164 100 <- Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 19:52:24 Download gff for LP21778.complete
Subject Subject Range Query Range Percent Splice Strand
3L 2502391..2502536 1..146 100   Minus
3L 2499691..2500462 147..918 100 <- Minus
3L 2499378..2499623 919..1164 100 <- Minus

LP21778.pep Sequence

Translation from 0 to 1004

> LP21778.pep
FVRYPKTISLGPKMCNANCCSNPKGKAGTKTAINNTNWPDIIPTPESLLY
PYEVIEEIADFITKGSGMRPKIGIICGSGLGSLADMIQDPKIFEYEKIPN
FPVSTVEGHAGRLVVGTLEGATVMAMQGRFHFYEGYPLAKCSMPVRVMKL
CGVEYLFATNAAGGINPRFAVGDIMLMHDHVNMLGFAGNSPLQGPNDPRF
GPRFPALVNSYNKDLINKAIEIAKAMGIESNIHVGVYSCLGGPNYETIAE
LKALRMMGVDAVGMSTVHEVITARHCDMKVFAFSLITNKCATEYSDKKDD
EANHDEVMAVAKNRQKACCELVSRLIREIHLASA*

LP21778.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2014-11-28 11:43:35
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF24862-PA 418 GF24862-PA 39..417 14..334 1474 75.7 Plus
Dana\GF11825-PA 337 GF11825-PA 1..327 14..330 661 40.7 Plus
Blast to dere-all-translation-r1.3.fasta performed 2014-11-28 11:43:37
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG14512-PA 351 GG14512-PA 27..350 9..333 1504 88 Plus
Dere\GG20005-PA 338 GG20005-PA 1..336 14..331 679 41.3 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2014-11-28 11:43:38
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH15756-PA 390 GH15756-PA 41..387 14..330 1450 79.8 Plus
Dgri\GH20577-PA 323 GH20577-PA 1..320 14..330 739 45.4 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 11:43:34
Subject Length Description Subject Range Query Range Score Percent Strand
CG16758-PE 321 CG16758-PE 1..321 14..334 1699 100 Plus
CG16758-PG 372 CG16758-PG 38..372 7..334 1568 90.5 Plus
CG16758-PF 328 CG16758-PF 1..328 14..334 1561 91.8 Plus
CG16758-PH 396 CG16758-PH 38..396 7..334 1533 84.5 Plus
CG16758-PD 329 CG16758-PD 3..329 11..334 1509 90.9 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2014-11-28 11:43:40
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI12534-PA 392 GI12534-PA 42..389 14..330 1452 79 Plus
Dmoj\GI19771-PA 323 GI19771-PA 1..320 14..330 690 41 Plus
Blast to dper-all-translation-r1.3.fasta performed 2014-11-28 11:43:41
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL17590-PA 330 GL17590-PA 1..327 14..330 777 47.1 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2014-11-28 11:43:42
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA14131-PA 396 GA14131-PA 64..396 18..333 1417 79.7 Plus
Dpse\GA14805-PA 333 GA14805-PA 1..330 14..330 765 47 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2014-11-28 11:43:44
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM14117-PA 396 GM14117-PA 38..396 7..334 1552 83.4 Plus
Dsec\GM15517-PA 339 GM15517-PA 1..337 14..331 673 41 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2014-11-28 11:43:45
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD13387-PA 396 GD13387-PA 38..396 7..334 1555 83.7 Plus
Dsim\GD25021-PA 339 GD25021-PA 1..337 14..331 682 41.6 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2014-11-28 11:43:47
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ16051-PA 408 GJ16051-PA 50..408 4..333 1468 78.6 Plus
Dvir\GJ18292-PA 325 GJ18292-PA 1..322 14..330 800 48.9 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2014-11-28 11:43:48
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK12508-PA 413 GK12508-PA 59..413 13..333 1468 78.6 Plus
Dwil\GK23168-PA 324 GK23168-PA 36..321 40..330 759 48.8 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2014-11-28 11:43:50
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE21703-PA 394 GE21703-PA 36..394 7..334 1550 83.4 Plus
Dyak\GE11540-PA 335 GE11540-PA 1..333 14..331 689 41.5 Plus

LP21778.hyp Sequence

Translation from 0 to 1004

> LP21778.hyp
FVRYPKTISLGPKMCNANCCSNPKGKAGTKTAINNTNWPDIIPTPESLLY
PYEVIEEIADFITKGSGMRPKIGIICGSGLGSLADMIQDPKIFEYEKIPN
FPVSTVEGHAGRLVVGTLEGATVMAMQGRFHFYEGYPLAKCSMPVRVMKL
CGVEYLFATNAAGGINPRFAVGDIMLMHDHVNMLGFAGNSPLQGPNDPRF
GPRFPALVNSYNKDLINKAIEIAKAMGIESNIHVGVYSCLGGPNYETIAE
LKALRMMGVDAVGMSTVHEVITARHCDMKVFAFSLITNKCATEYSDKKDD
EANHDEVMAVAKNRQKACCELVSRLIREIHLASA*

LP21778.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:43:12
Subject Length Description Subject Range Query Range Score Percent Strand
CG16758-PE 321 CG16758-PE 1..321 14..334 1699 100 Plus
CG16758-PG 372 CG16758-PG 38..372 7..334 1568 90.5 Plus
CG16758-PF 328 CG16758-PF 1..328 14..334 1561 91.8 Plus
CG16758-PH 396 CG16758-PH 38..396 7..334 1533 84.5 Plus
CG16758-PD 329 CG16758-PD 3..329 11..334 1509 90.9 Plus