Clone LP21789 Report

Search the DGRC for LP21789

Clone and Library Details

Library:LP
Tissue Source:Drosophila melanogaster larval-early pupal
Created by:Ling Hong
Date Registered:1998-06-11
Comments:Sized fractionated cDNAs were directly ligated into pOT2. Plasmid cDNA library.
Original Plate Number:217
Well:89
Vector:pOT2
Associated Gene/TranscriptSdc-RD
Protein status:LP21789.pep: gold
Sequenced Size:1847

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
Sdc-RD 2010-11-11 Gleaning Pick By Joe Carlson

Clone Sequence Records

LP21789.complete Sequence

1847 bp assembled on 2010-12-09

GenBank Submission: BT125826.1

> LP21789.complete
CGGTTACGTCCGGATTTTAGCGCGATTTCGTGTCTGTTGTTTGGTCGGCA
CTCGAGTGTAAAGAAATTTGTACATCCCCGAAAAGAATCGCGAGTGCAAT
TTTGTAAATACGGAGAGGAAAAGCGTTCTTCTAGTGTGAAACCAGTTTAA
AAAGCTGCAAGAAATATATATAGCTCAATATATATATTTATATATGTGTG
CCGCCGCCAGTTCTAATCTTTAAATCAATAAACAAAACTGGAAGCCATTA
GCTGAAATCACAACAACAGCAACCGCAGAAGAAACCAACGGGGAAAATGA
AGCCAAAGCAGAAGATTTCCGTAGAGCCGCTATTGCTAGTCGCAATTCTC
ATCGGAGTTCTGGTAGCCGCCACCCACGCTCAAGATCAGAAATCGGTGAA
ACCATCGGCGGCAGCGCCATCAGCAGCAGCTTCTCGGCCCCATGATGAAA
TCTATATCGACGATGATAGCATCGAGGGATCCGGCGGACGCGGCGGTATA
CACGAAGATCTAGAGAAAGATCCGGACTATTCTGGCTCCGGCTTTGGACC
CGATGACGAGGACGCCGAACCCGATCAGCATTCGCACAGTTCGCACAACA
CGCGCATCTCGCAGAGCAGCAACTCCGGCATAAACACTCATACACCAACA
CAAACCTCATCCACAATCCCAACAACATCGACTTCGACACCAATGCCGAC
AACAACCCCCACAGCGACAACCCCCGCATCCACCACAACGGCGGCAGCAA
CCCAGATATCGTCCTTTGCCAATAGCAGTAGCACCACCACCACCACGTTG
GCTCCCACGATTCCCGCAGAACCGCAGCAACCGCTGTTCCCGCCATTCGA
CAAGGATCTGGATACGGAGTCCAGCGGCGATGGCATCGATGCTGATGCTG
AGGATGACGATGAGGACGATGGCGACGATAAGGACTATGACTATAACAAG
GAGCTGGACAAAGAAATCGACATCGATGGTCCCGAGCCGGGACATCTGCC
GCCAGTTGTCCATCATAATACCGTTGAAACTGGTCACATACCCACTACGG
ATGAAATCGATGTGGATGGCGGCGATGAGGATGACAATGGGGATAGCGAC
ATCGATGGTCCGCGGATCGGTGGCAACGATGGAGATATTACAGAGCGCGG
ACCGGGTGCAGGTGGCAGCAACGTGCACGAATTGGACCCCAATACGAACG
TGAATAGCCAGCCCTCCGACACAAAGGGCATCGATCACAGGCCCAACGGC
AACGAAGTGGTCATCATGAGCGAGGACGATCGCACGTCGAGCTTCTTCTC
GCAGCCCGGAATTCTGGCTGCTGTCATTGGCGGTGCCGTCGTTGGCCTGC
TCTGCGCCATACTCGTGGTCATGTTCATCGTGTACCGCATGAGGAAAAAG
GACGAGGGATCCTATGCGCTGGACGAGCCAAAGAGATCGCCGGCCAACAA
TTCGTATGCGAAAAATGCGAATAACCGCGAGTTCTACGCCTGAGATAATG
GCACGTCGCGCAGGTATTAAGTTGACCACAAGTGCAGGAACAAAGTGTGC
GTAAGGACGGAACGGTGTGCGTATGACTGGACGAAGGCGGAGCGACTGGG
TTTGGTTTGGCTCAACTGAATACACTGTGCGGAGTGGTGGGGGTGCAGCA
TCATCGGCAAACCACTGAAACAAGGATTAATCATCCGCAGCAGCAGCTAC
AAAACTAACACAAAAACAAATGAAAATTTCAAACGTTTTCAAACACACAC
AATTTTTCGTGAGGGGTAAATTAAATTAAAACAAAACAAGAAAAGAACAC
AAATCGGCAATATAATAACGAGGAAAAACAAAAAAAAAAAAAAAAAA

LP21789.complete Blast Records

Blast to d_melanogaster_OreR.fa performed 2014-11-27 16:33:50
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 17284613..17285131 1152..637 2500 99.2 Minus
chr2R 21145070 chr2R 17280773..17281283 1829..1320 2475 99.4 Minus
chr2R 21145070 chr2R 17366599..17366866 389..122 1340 100 Minus
chr2R 21145070 chr2R 17281425..17281592 1320..1153 825 99.4 Minus
chr2R 21145070 chr2R 17285726..17285864 636..498 695 100 Minus
chr2R 21145070 chr2R 17367522..17367644 123..1 600 99.2 Minus
chr2R 21145070 chr2R 17298835..17298945 497..387 555 100 Minus
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 16:33:47
Subject Length Description Subject Range Query Range Score Percent Strand
Sdc-RD 1197 CG10497-PD 1..1197 297..1493 5985 100 Plus
Sdc-RA 1200 CG10497-PA 1..1200 297..1493 5920 99.8 Plus
Sdc-RJ 1488 CG10497-PJ 632..1488 637..1493 4285 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 16:33:46
Subject Length Description Subject Range Query Range Score Percent Strand
Sdc-RD 1869 CG10497-RD 41..1869 1..1829 9145 100 Plus
Sdc-RA 2482 CG10497-RA 41..1872 1..1829 9080 99.8 Plus
Sdc-RH 2245 CG10497-RH 195..1635 389..1829 7205 100 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 16:33:49
Subject Length Description Subject Range Query Range Score Percent Strand
Sdc-PD 398 CG10497-PD 7..398 315..1490 1318 100 Plus
Sdc-PA 399 CG10497-PA 7..399 315..1490 1306 99.7 Plus
Sdc-PH 266 CG10497-PH 40..266 810..1490 944 100 Plus
Sdc-PI 494 CG10497-PI 268..494 810..1490 944 100 Plus
Sdc-PJ 495 CG10497-PJ 269..495 810..1490 944 100 Plus
Sdc-PI 494 CG10497-PI 7..114 315..638 418 99.1 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 16:33:43
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 21394214..21394736 1842..1320 2615 100 Minus
2R 25286936 2R 21398065..21398580 1152..637 2580 100 Minus
2R 25286936 2R 21480091..21480358 389..122 1340 100 Minus
2R 25286936 2R 21394878..21395045 1320..1153 840 100 Minus
2R 25286936 2R 21399175..21399313 636..498 695 100 Minus
2R 25286936 2R 21481014..21481136 123..1 615 100 Minus
2R 25286936 2R 21412311..21412421 497..387 555 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 23:03:47
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 21395413..21395935 1842..1320 2615 100 Minus
2R 25260384 2R 21399264..21399779 1152..637 2580 100 Minus
2R 25260384 2R 21481290..21481557 389..122 1340 100 Minus
2R 25260384 2R 21396077..21396244 1320..1153 840 100 Minus
2R 25260384 2R 21400374..21400512 636..498 695 100 Minus
2R 25260384 2R 21482213..21482335 123..1 615 100 Minus
2R 25260384 2R 21413510..21413620 497..387 555 100 Minus
Blast to na_te.dros performed 2014-11-27 16:33:44
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2374..2533 574..735 173 61.2 Plus
roo 9092 roo DM_ROO 9092bp 1060..1132 245..314 114 65.8 Plus

LP21789.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2014-11-27 17:53:36 Download gff for LP21789.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 17367522..17367644 1..123 99   Minus
chr2R 17366599..17366864 124..389 100 <- Minus
chr2R 17298835..17298942 390..497 100 <- Minus
chr2R 17285726..17285864 498..636 100 <- Minus
chr2R 17284891..17285131 637..874 98 <- Minus
chr2R 17284613..17284812 953..1152 99 == Minus
chr2R 17281425..17281592 1153..1320 99 <- Minus
chr2R 17280837..17281282 1321..1765 99 <- Minus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2010-12-10 09:34:19 Download gff for LP21789.complete
Subject Subject Range Query Range Percent Splice Strand
Sdc-RD 1..1197 297..1493 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-03 20:34:11 Download gff for LP21789.complete
Subject Subject Range Query Range Percent Splice Strand
Sdc-RD 1..1197 297..1493 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 17:53:36 Download gff for LP21789.complete
Subject Subject Range Query Range Percent Splice Strand
Sdc-RD 1..1197 297..1493 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2010-12-10 09:34:19 Download gff for LP21789.complete
Subject Subject Range Query Range Percent Splice Strand
Sdc-RD 40..1868 1..1829 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-03 20:34:11 Download gff for LP21789.complete
Subject Subject Range Query Range Percent Splice Strand
Sdc-RD 41..1869 1..1829 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 17:53:36 Download gff for LP21789.complete
Subject Subject Range Query Range Percent Splice Strand
Sdc-RD 41..1869 1..1829 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 17:53:36 Download gff for LP21789.complete
Subject Subject Range Query Range Percent Splice Strand
2R 21481014..21481136 1..123 100   Minus
2R 21480091..21480356 124..389 100 <- Minus
2R 21412311..21412418 390..497 100 <- Minus
2R 21399175..21399313 498..636 100 <- Minus
2R 21398065..21398580 637..1152 100 <- Minus
2R 21394878..21395045 1153..1320 100 <- Minus
2R 21394227..21394735 1321..1829 100 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-03 20:34:11 Download gff for LP21789.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 17368519..17368641 1..123 100   Minus
arm_2R 17367596..17367861 124..389 100 <- Minus
arm_2R 17299816..17299923 390..497 100 <- Minus
arm_2R 17286680..17286818 498..636 100 <- Minus
arm_2R 17285570..17286085 637..1152 100 <- Minus
arm_2R 17282383..17282550 1153..1320 100 <- Minus
arm_2R 17281732..17282240 1321..1829 100 <- Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 19:52:26 Download gff for LP21789.complete
Subject Subject Range Query Range Percent Splice Strand
2R 21482213..21482335 1..123 100   Minus
2R 21481290..21481555 124..389 100 <- Minus
2R 21413510..21413617 390..497 100 <- Minus
2R 21400374..21400512 498..636 100 <- Minus
2R 21399264..21399779 637..1152 100 <- Minus
2R 21396077..21396244 1153..1320 100 <- Minus
2R 21395426..21395934 1321..1829 100 <- Minus

LP21789.pep Sequence

Translation from 296 to 1492

> LP21789.pep
MKPKQKISVEPLLLVAILIGVLVAATHAQDQKSVKPSAAAPSAAASRPHD
EIYIDDDSIEGSGGRGGIHEDLEKDPDYSGSGFGPDDEDAEPDQHSHSSH
NTRISQSSNSGINTHTPTQTSSTIPTTSTSTPMPTTTPTATTPASTTTAA
ATQISSFANSSSTTTTTLAPTIPAEPQQPLFPPFDKDLDTESSGDGIDAD
AEDDDEDDGDDKDYDYNKELDKEIDIDGPEPGHLPPVVHHNTVETGHIPT
TDEIDVDGGDEDDNGDSDIDGPRIGGNDGDITERGPGAGGSNVHELDPNT
NVNSQPSDTKGIDHRPNGNEVVIMSEDDRTSSFFSQPGILAAVIGGAVVG
LLCAILVVMFIVYRMRKKDEGSYALDEPKRSPANNSYAKNANNREFYA*

LP21789.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2014-11-28 11:44:13
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF12095-PA 438 GF12095-PA 314..438 276..398 583 92 Plus
Blast to dere-all-translation-r1.3.fasta performed 2014-11-28 11:44:15
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG20776-PA 406 GG20776-PA 1..120 1..119 520 98.3 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2014-11-28 11:44:18
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH20057-PA 120 GH20057-PA 5..120 275..398 533 81.6 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 11:44:10
Subject Length Description Subject Range Query Range Score Percent Strand
Sdc-PD 398 CG10497-PD 1..398 1..398 2092 100 Plus
Sdc-PA 399 CG10497-PA 1..399 1..398 2080 99.7 Plus
Sdc-PI 494 CG10497-PI 1..494 1..398 1541 66.2 Plus
Sdc-PJ 495 CG10497-PJ 1..495 1..398 1527 66.3 Plus
Sdc-PH 266 CG10497-PH 1..266 133..398 1411 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2014-11-28 11:44:20
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI20467-PA 426 GI20467-PA 45..426 30..398 686 52.8 Plus
Blast to dper-all-translation-r1.3.fasta performed 2014-11-28 11:44:22
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL17492-PA 468 GL17492-PA 353..468 282..398 604 97.4 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2014-11-28 11:44:25
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA10355-PB 423 GA10355-PB 308..423 282..398 601 97.4 Plus
Dpse\GA10355-PD 223 GA10355-PD 113..223 288..398 580 97.3 Plus
Dpse\GA10355-PD 223 GA10355-PD 34..141 37..143 319 64.8 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2014-11-28 11:44:27
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM15720-PA 388 GM15720-PA 1..388 1..398 1453 93.5 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2014-11-28 11:44:29
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD25198-PA 398 GD25198-PA 1..398 1..398 1583 96.7 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2014-11-28 11:44:31
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ22317-PA 433 GJ22317-PA 327..433 293..398 524 89.7 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2014-11-28 11:44:34
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK20743-PA 570 GK20743-PA 32..142 12..110 246 61.3 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2014-11-28 11:44:36
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE13713-PA 499 GE13713-PA 204..499 110..398 1010 84.1 Plus
Dyak\GE13713-PA 499 GE13713-PA 1..114 1..114 516 97.4 Plus

LP21789.hyp Sequence

Translation from 296 to 1492

> LP21789.hyp
MKPKQKISVEPLLLVAILIGVLVAATHAQDQKSVKPSAAAPSAAASRPHD
EIYIDDDSIEGSGGRGGIHEDLEKDPDYSGSGFGPDDEDAEPDQHSHSSH
NTRISQSSNSGINTHTPTQTSSTIPTTSTSTPMPTTTPTATTPASTTTAA
ATQISSFANSSSTTTTTLAPTIPAEPQQPLFPPFDKDLDTESSGDGIDAD
AEDDDEDDGDDKDYDYNKELDKEIDIDGPEPGHLPPVVHHNTVETGHIPT
TDEIDVDGGDEDDNGDSDIDGPRIGGNDGDITERGPGAGGSNVHELDPNT
NVNSQPSDTKGIDHRPNGNEVVIMSEDDRTSSFFSQPGILAAVIGGAVVG
LLCAILVVMFIVYRMRKKDEGSYALDEPKRSPANNSYAKNANNREFYA*

LP21789.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:43:46
Subject Length Description Subject Range Query Range Score Percent Strand
Sdc-PD 398 CG10497-PD 1..398 1..398 2092 100 Plus
Sdc-PA 399 CG10497-PA 1..399 1..398 2080 99.7 Plus
Sdc-PI 494 CG10497-PI 1..494 1..398 1541 66.2 Plus
Sdc-PJ 495 CG10497-PJ 1..495 1..398 1527 66.3 Plus
Sdc-PH 266 CG10497-PH 1..266 133..398 1411 100 Plus