Clone LP24142 Report

Search the DGRC for LP24142

Clone and Library Details

Library:LP
Tissue Source:Drosophila melanogaster larval-early pupal
Created by:Ling Hong
Date Registered:1998-06-11
Comments:Sized fractionated cDNAs were directly ligated into pOT2. Plasmid cDNA library.
Original Plate Number:241
Well:42
Vector:pOT2
Associated Gene/TranscriptCG32521-RA
Protein status:LP24142.pep: gold
Sequenced Size:1712

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG32521-RC 2010-06-24 Manual selection by Sue Celniker

Clone Sequence Records

LP24142.complete Sequence

1712 bp assembled on 2010-12-14

GenBank Submission: BT125852.1

> LP24142.complete
TCAGTTGGGCTCCCGACGGTTTAATTTTTAGCTCCCACAACGAACGCAGT
TCTCAGCGATTTTGACGCAAATTATAAACGTCAGCAACTTTTGATCCAAG
GGCGTGACATCGATAGCGAGCAACAGGATGCTGGCACTGCCTTTGCTGAC
TCTGGCGGTCCTCGCCAGCTGCGGCTACTCCGTGGACGCCTACTCCAAGT
ACGGCCGTGGATGCGGGGACATTGGCTGCCTGCCCACCGAGGAGTGCGTC
ATCACCAGCGACTCGTGCAGCTACAACCAGCGTGACGGCAAGGATTGCGG
CAACTATCCCACCTGCAAACGGCGCTCCGGCGGAGGATCATCCGCCTCGA
ACAGCAGCCCCAACTTGGCAGCCCCCTCGGCCAATCCGTCAGAGGTGAGC
CATAACGCATACGCCCCGAATGCCCCAAGTGCCCCGAGTGCCCCGTTGCC
GGAAGCGGATGCGAGCGGTGGTGCTGGCTACGGTGGTGCTGCGGGCGGTG
GTGGAAGCGGCGGATATGGTGGTGGTTTCTCGGCTGGCGGCCACTCCCTG
TACCCCAGCCTACCCAACTCAAACGGCGGCGGCGGTGGTGCGGCTCCCTA
CAATCCATATGGCAGTGGTGGCGGCAACGGTGGATACGGCGGCTACAATC
CCTACAACGGCGGCTACCAGCCACCATCTTCTGGCGGCTATCAACCTCAA
GCTCCTGGCGGATACCAACCCAGACCGGGCTACACGCCACCCGCCCCAGG
CTACGATAACAACGGTGGTGGTGGTGCCCAGAAACCCAAGGACAAAGAGG
GCGGCTTCTTCTCCAATTTCTTCTCGAATCCGGCGGTGAGTCAAGCGGTG
TCCGGTATCATTGCAGGCCAGATAGCCAAGCAACTGCAAGGCGGCGGAGC
CGGAGGACCAGGTGGTGGACAGCCGGCTGGCGGCTACCAGCCAAGCGGTG
GCTATGGCGGAGGACCAGCAGCAGGAGGCGGCGGATCCGGTGGTAGTAAC
ATACTTGGCGGTCTCTTGGGATCCGTTCTATCCGGCGGCGGTGGTGGTAA
TGCAGGCGCTGGCGGCGGTAGTGCTAGCAGCTTCCTGGGGAGTCTGCTCA
GCGGTGGAAATTCCAACAGAGGCGCTCAGCAAGGAGGCGGAGGTTCTGGA
GGACTGGGCGACATCTTCAGCTCGAAAAACTTTGGCGGCCTCTTCAGTGA
GAATCCCTCATCCAGGAGCGGCAGTCCCTCATCCTCCTCCGACGGAGGAG
CCAAGGGCTATCCCACCCAGGCACCGGGCAACTATTATGGCTAAGCTGCA
GCGACTGAAGTAGCTAGCCTAGCATTCCATGTGGAGATCGACTTTGGAGT
CTCCTTTCAAAACAGTCTTTTTTTCGTCCTTCGGCAATGTAATCAAATGG
AGAACTTTCAACGACATTAACTGAAACAATATTGAAATATATAAGCATAT
TATTCGAAACTATTAATGACGATATACAAATACAATACATATATATATAT
AAACATATATACTCGATAAATGAGAGAACAGTCAGATGTAATTTGAGATA
CCGTGCGCGTAGAATCCCCCAGAAAACAACAGATCCCAATTCGAAGTTCA
TTTGTAAATAGAAAAGTAACTGATATTGAATTTAAACAAGATAATATACG
TAAGAATTGAAAGCCAGAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA
AAAAAAAAAAAA

LP24142.complete Blast Records

Blast to d_melanogaster_OreR.fa performed 2014-11-27 16:40:02
Subject Length Description Subject Range Query Range Score Percent Strand
chrX 22417052 chrX 21070467..21071744 1667..390 6390 100 Minus
chrX 22417052 chrX 21076237..21076431 392..198 975 100 Minus
chrX 22417052 chrX 21076844..21076959 197..82 580 100 Minus
chrX 22417052 chrX 21146201..21146281 81..1 405 100 Minus
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 16:40:00
Subject Length Description Subject Range Query Range Score Percent Strand
CG32521-RD 1167 CG32521-PD 1..1167 128..1294 5835 100 Plus
CG32521-RB 1167 CG32521-PB 1..1167 128..1294 5835 100 Plus
CG32521-RA 1167 CG32521-PA 1..1167 128..1294 5835 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 16:39:58
Subject Length Description Subject Range Query Range Score Percent Strand
CG32521-RA 1714 CG32521-RA 48..1714 1..1667 8335 100 Plus
CG32521-RD 1691 CG32521-RD 30..1691 1..1667 8225 99.7 Plus
CG32521-RB 1782 CG32521-RB 200..1782 85..1667 7915 100 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 16:40:01
Subject Length Description Subject Range Query Range Score Percent Strand
CG32521-PD 388 CG32521-PD 14..242 167..853 469 100 Plus
CG32521-PB 388 CG32521-PB 14..242 167..853 469 100 Plus
CG32521-PA 388 CG32521-PA 14..242 167..853 469 100 Plus
CG32521-PG 230 CG32521-PG 14..66 167..325 309 100 Plus
CG32521-PE 233 CG32521-PE 14..66 167..325 309 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 16:39:56
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 21205310..21206587 1667..390 6390 100 Minus
X 23542271 X 21211080..21211274 392..198 975 100 Minus
X 23542271 X 21211687..21211802 197..82 580 100 Minus
X 23542271 X 21281044..21281124 81..1 405 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 23:04:12
Subject Length Description Subject Range Query Range Score Percent Strand
X 23527363 X 21190402..21191679 1667..390 6390 100 Minus
X 23527363 X 21196172..21196366 392..198 975 100 Minus
X 23527363 X 21196779..21196894 197..82 580 100 Minus
X 23527363 X 21266136..21266216 81..1 405 100 Minus
Blast to na_te.dros performed on 2014-11-27 16:39:57 has no hits.

LP24142.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2014-11-27 17:55:47 Download gff for LP24142.complete
Subject Subject Range Query Range Percent Splice Strand
chrX 21146199..21146281 1..84 97   Minus
chrX 21076844..21076956 85..197 100 <- Minus
chrX 21076237..21076431 198..392 100 <- Minus
chrX 21071670..21071741 393..464 100 <- Minus
chrX 21070467..21071607 527..1667 96 == Minus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2010-12-14 18:27:28 Download gff for LP24142.complete
Subject Subject Range Query Range Percent Splice Strand
CG32521-RB 1..1167 128..1294 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-03 20:36:37 Download gff for LP24142.complete
Subject Subject Range Query Range Percent Splice Strand
CG32521-RA 1..1167 128..1294 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 17:55:47 Download gff for LP24142.complete
Subject Subject Range Query Range Percent Splice Strand
CG32521-RA 1..1167 128..1294 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2010-12-14 18:27:28 Download gff for LP24142.complete
Subject Subject Range Query Range Percent Splice Strand
CG32521-RA 48..1714 1..1667 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-03 20:36:37 Download gff for LP24142.complete
Subject Subject Range Query Range Percent Splice Strand
CG32521-RA 48..1714 1..1667 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 17:55:47 Download gff for LP24142.complete
Subject Subject Range Query Range Percent Splice Strand
CG32521-RA 48..1714 1..1667 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 17:55:47 Download gff for LP24142.complete
Subject Subject Range Query Range Percent Splice Strand
X 21281042..21281124 1..84 97   Minus
X 21211687..21211799 85..197 100 <- Minus
X 21211080..21211274 198..392 100 <- Minus
X 21205310..21206584 393..1667 100 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-03 20:36:37 Download gff for LP24142.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 21152069..21152151 1..84 97   Minus
arm_X 21082714..21082826 85..197 100 <- Minus
arm_X 21082107..21082301 198..392 100 <- Minus
arm_X 21076337..21077611 393..1667 100 <- Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 19:53:12 Download gff for LP24142.complete
Subject Subject Range Query Range Percent Splice Strand
X 21266134..21266216 1..84 97   Minus
X 21196779..21196891 85..197 100 <- Minus
X 21196172..21196366 198..392 100 <- Minus
X 21190402..21191676 393..1667 100 <- Minus

LP24142.pep Sequence

Translation from 127 to 1293

> LP24142.pep
MLALPLLTLAVLASCGYSVDAYSKYGRGCGDIGCLPTEECVITSDSCSYN
QRDGKDCGNYPTCKRRSGGGSSASNSSPNLAAPSANPSEVSHNAYAPNAP
SAPSAPLPEADASGGAGYGGAAGGGGSGGYGGGFSAGGHSLYPSLPNSNG
GGGGAAPYNPYGSGGGNGGYGGYNPYNGGYQPPSSGGYQPQAPGGYQPRP
GYTPPAPGYDNNGGGGAQKPKDKEGGFFSNFFSNPAVSQAVSGIIAGQIA
KQLQGGGAGGPGGGQPAGGYQPSGGYGGGPAAGGGGSGGSNILGGLLGSV
LSGGGGGNAGAGGGSASSFLGSLLSGGNSNRGAQQGGGGSGGLGDIFSSK
NFGGLFSENPSSRSGSPSSSSDGGAKGYPTQAPGNYYG*

LP24142.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2014-11-28 12:07:25
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF21850-PA 366 GF21850-PA 7..89 2..88 418 89.7 Plus
Dana\GF21851-PA 290 GF21851-PA 28..290 139..388 409 70.4 Plus
Blast to dere-all-translation-r1.3.fasta performed 2014-11-28 12:07:28
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG17550-PA 398 GG17550-PA 1..398 1..388 1025 83.9 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2014-11-28 12:07:31
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH12894-PA 283 GH12894-PA 26..282 141..388 404 68.6 Plus
Dgri\GH12893-PA 368 GH12893-PA 12..76 6..71 287 74.2 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 12:07:22
Subject Length Description Subject Range Query Range Score Percent Strand
CG32521-PD 388 CG32521-PD 1..388 1..388 2116 100 Plus
CG32521-PB 388 CG32521-PB 1..388 1..388 2116 100 Plus
CG32521-PA 388 CG32521-PA 1..388 1..388 2116 100 Plus
CG32521-PI 323 CG32521-PI 23..323 88..388 1641 99.7 Plus
CG32521-PG 230 CG32521-PG 53..230 210..388 765 84.9 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2014-11-28 12:07:33
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI14447-PA 626 GI14447-PA 329..510 91..272 358 71.3 Plus
Dmoj\GI14447-PA 626 GI14447-PA 4..62 7..72 256 65.2 Plus
Dmoj\GI13642-PA 260 GI13642-PA 14..81 8..75 175 42.6 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2014-11-28 12:07:40
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA23110-PA 355 GA23110-PA 29..355 87..388 408 61.6 Plus
Dpse\GA23109-PA 411 GA23109-PA 17..128 1..88 260 54.8 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2014-11-28 12:07:43
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM22635-PA 381 GM22635-PA 1..245 1..253 867 89.7 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2014-11-28 12:07:47
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ18785-PA 643 GJ18785-PA 341..500 101..254 385 72.2 Plus
Dvir\GJ18785-PA 643 GJ18785-PA 10..84 18..94 272 67.5 Plus
Dvir\GJ13977-PA 236 GJ13977-PA 9..65 19..75 153 45.6 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2014-11-28 12:07:51
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK19936-PA 719 GK19936-PA 431..588 104..254 324 64.3 Plus
Dwil\GK19936-PA 719 GK19936-PA 86..153 1..68 308 73.5 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2014-11-28 12:07:54
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE15311-PA 399 GE15311-PA 1..399 1..388 959 86.3 Plus

LP24142.hyp Sequence

Translation from 127 to 1293

> LP24142.hyp
MLALPLLTLAVLASCGYSVDAYSKYGRGCGDIGCLPTEECVITSDSCSYN
QRDGKDCGNYPTCKRRSGGGSSASNSSPNLAAPSANPSEVSHNAYAPNAP
SAPSAPLPEADASGGAGYGGAAGGGGSGGYGGGFSAGGHSLYPSLPNSNG
GGGGAAPYNPYGSGGGNGGYGGYNPYNGGYQPPSSGGYQPQAPGGYQPRP
GYTPPAPGYDNNGGGGAQKPKDKEGGFFSNFFSNPAVSQAVSGIIAGQIA
KQLQGGGAGGPGGGQPAGGYQPSGGYGGGPAAGGGGSGGSNILGGLLGSV
LSGGGGGNAGAGGGSASSFLGSLLSGGNSNRGAQQGGGGSGGLGDIFSSK
NFGGLFSENPSSRSGSPSSSSDGGAKGYPTQAPGNYYG*

LP24142.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:49:20
Subject Length Description Subject Range Query Range Score Percent Strand
CG32521-PD 388 CG32521-PD 1..388 1..388 2116 100 Plus
CG32521-PB 388 CG32521-PB 1..388 1..388 2116 100 Plus
CG32521-PA 388 CG32521-PA 1..388 1..388 2116 100 Plus
CG32521-PI 323 CG32521-PI 23..323 88..388 1641 99.7 Plus
CG32521-PG 230 CG32521-PG 53..230 210..388 765 84.9 Plus