Clone MIP01849 Report

Search the DGRC for MIP01849

Clone and Library Details

Library:MIP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by:
Date Registered:2008-10-08
Comments:
Original Plate Number:231
Well:49
Vector:pOT2
Associated Gene/TranscriptCG3640-RA
Protein status:MIP01849.pep: gold
Sequenced Size:1020

Clone Sequence Records

MIP01849.complete Sequence

1020 bp assembled on 2009-02-21

GenBank Submission: BT066305.1

> MIP01849.complete
AGTCAACAATGTTTTCGATCAGAGTGTGGTTCATCTGCCTGGTGATAGTT
ACCCTCAACTCCTTTCCCGCCTACTCCTGGGATTATTGCCAAGAGCACTG
GTGTCCGCGTTCCACCGACCACGTAGCGTGCAACAACAACGGGACGTTTG
GCCTCGATTGCGGAAGGGAGGCCAGGCTAATCCCGCTCAGCAATCAGTTG
CAGGCGTTCATTGTGCACCAGGTAAACTTCTATCGCAACCAGGTGGCTTC
GGGCGGACTCTCCGCCTTCGGACCCGCCCGCCGAATGGCTAGTGTCCGCT
GGGATCCCGAGCTGGCACAGCTGGCTGAGCTGGCGGCAAAGAGGTGCAGT
TTGTCCGGCGATGGATGCCGCAACACCAGGCGATTCAAGCACGTGGGCCA
GCTGACGGGCCACGTAATCTTCAGTGCGGGAAAGCACAGCGACTTGGAGC
TGCTGCGCCACAAGATCTCGAATTGGTTTGGCCAGTACATGAGAGCCAGC
AAGGATCTGCAAGCCGCCGATCCATCAAGCAACATCAGCAGCTTCCGGCA
GTTGATACAGGAAAGCTCCACCCACATGGGATGCGGCGTGCTCCGCCAGA
GGAGCCACATGCTGTGGCACCAGCAGTTCATCGTCTGTAACTTTGCCCGT
AGGAATATGCCCCGCGAGCAGGTCTACCAGGTGGGCGTGGCTGCCACAGG
ATGCAGGTCGGGAAGGAATCCTCGCTATCCCAATCTCTGCGCTCTGCAGG
AAGAATACGATGTGAACGCCGTCGACCGTTTTCACTCAAAGCGGCCACTT
AGGATAAGGTTCAAGTACAGCGCATCCCATCCATCGAAAGTTTTGGGTGC
TGATCGTGATGTAGCCTTCCATCCCAATATCAAGTTGGGACGTCTTTAAT
ATATCTGGAGCTGAGTGGGTACTTTCTTAAATATATTTCAAATGTAACTT
CCACTAGATTAAAATGCTTTACATTTTCTGTTTGGCGATTTTACGAAAAA
AAAAAAAAAAAAAAAAAAAA

MIP01849.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 21:24:51
Subject Length Description Subject Range Query Range Score Percent Strand
CG3640-RA 1056 CG3640-RA 63..1056 1..994 4970 100 Plus
CG4781-RA 1555 CG4781-RA 1482..1555 994..921 370 100 Minus
Blast to d_melanogaster_OreR.fa performed 2014-11-27 13:32:46
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 20525791..20526642 143..994 4230 99.8 Plus
chr2R 21145070 chr2R 20525574..20525716 1..143 715 100 Plus
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 13:32:43
Subject Length Description Subject Range Query Range Score Percent Strand
CG3640-RA 891 CG3640-PA 1..891 9..899 4455 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 20:00:27 has no hits.
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 13:32:41
Subject Length Description Subject Range Query Range Score Percent Strand
CG3640-RA 994 CG3640-RA 1..994 1..994 4970 100 Plus
CG4781-RA 1557 CG4781-RA 1484..1557 994..921 370 100 Minus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 13:32:44
Subject Length Description Subject Range Query Range Score Percent Strand
CG3640-PA 296 CG3640-PA 1..296 9..896 1596 100 Plus
CG17575-PA 291 CG17575-PA 6..283 27..761 427 34.2 Plus
CG17575-PB 298 CG17575-PB 6..290 27..761 420 33.3 Plus
CG42564-PA 500 CG10284-PA 54..284 81..761 357 34.7 Plus
CG9822-PA 263 CG9822-PA 13..259 39..767 345 33.2 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 13:32:39
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 24639905..24640756 143..994 4260 100 Plus
2R 25286936 2R 24639688..24639830 1..143 715 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:41:52
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 24641104..24641955 143..994 4260 100 Plus
2R 25260384 2R 24640887..24641029 1..143 715 100 Plus
Blast to na_te.dros performed on 2014-11-27 13:32:40 has no hits.

MIP01849.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2014-11-27 15:36:34 Download gff for MIP01849.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 20525792..20526642 144..995 99   Plus
chr2R 20525574..20525716 1..143 100 -> Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2009-10-19 18:06:22 Download gff for MIP01849.complete
Subject Subject Range Query Range Percent Splice Strand
CG3640-RA 1..891 9..899 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 21:37:22 Download gff for MIP01849.complete
Subject Subject Range Query Range Percent Splice Strand
CG3640-RA 1..891 9..899 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 17:43:33 Download gff for MIP01849.complete
Subject Subject Range Query Range Percent Splice Strand
CG3640-RA 1..891 9..899 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 15:36:34 Download gff for MIP01849.complete
Subject Subject Range Query Range Percent Splice Strand
CG3640-RA 1..891 9..899 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2009-02-21 17:15:12 Download gff for MIP01849.complete
Subject Subject Range Query Range Percent Splice Strand
CG3640-RA 1..891 9..899 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 21:37:22 Download gff for MIP01849.complete
Subject Subject Range Query Range Percent Splice Strand
CG3640-RA 1..994 1..994 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:43:33 Download gff for MIP01849.complete
Subject Subject Range Query Range Percent Splice Strand
CG3640-RA 1..994 1..994 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 15:36:34 Download gff for MIP01849.complete
Subject Subject Range Query Range Percent Splice Strand
CG3640-RA 1..994 1..994 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 15:36:34 Download gff for MIP01849.complete
Subject Subject Range Query Range Percent Splice Strand
2R 24639906..24640756 144..995 99   Plus
2R 24639688..24639830 1..143 100 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:43:33 Download gff for MIP01849.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 20527429..20528279 144..995 99   Plus
arm_2R 20527211..20527353 1..143 100 -> Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 19:11:07 Download gff for MIP01849.complete
Subject Subject Range Query Range Percent Splice Strand
2R 24641123..24641973 144..995 99   Plus
2R 24640905..24641047 1..143 100 -> Plus

MIP01849.pep Sequence

Translation from 2 to 898

> MIP01849.pep
STMFSIRVWFICLVIVTLNSFPAYSWDYCQEHWCPRSTDHVACNNNGTFG
LDCGREARLIPLSNQLQAFIVHQVNFYRNQVASGGLSAFGPARRMASVRW
DPELAQLAELAAKRCSLSGDGCRNTRRFKHVGQLTGHVIFSAGKHSDLEL
LRHKISNWFGQYMRASKDLQAADPSSNISSFRQLIQESSTHMGCGVLRQR
SHMLWHQQFIVCNFARRNMPREQVYQVGVAATGCRSGRNPRYPNLCALQE
EYDVNAVDRFHSKRPLRIRFKYSASHPSKVLGADRDVAFHPNIKLGRL*

MIP01849.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2014-11-26 16:37:58
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF12998-PA 288 GF12998-PA 5..285 13..281 1003 66.9 Plus
Dana\GF12004-PA 289 GF12004-PA 21..288 25..260 425 35.1 Plus
Dana\GF18358-PA 499 GF18358-PA 52..292 19..254 419 37.8 Plus
Dana\GF21595-PA 256 GF21595-PA 9..256 13..254 366 36.2 Plus
Dana\GF18165-PA 262 GF18165-PA 6..251 13..253 360 35.7 Plus
Blast to dere-all-translation-r1.3.fasta performed 2014-11-26 16:38:00
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG22996-PA 308 GG22996-PA 1..297 3..297 1339 82.8 Plus
Dere\GG22549-PA 301 GG22549-PA 25..293 25..253 414 33.8 Plus
Dere\GG13401-PA 555 GG13401-PA 47..283 19..253 357 35.7 Plus
Dere\GG20782-PA 263 GG20782-PA 13..259 13..255 342 32.4 Plus
Dere\GG13982-PA 277 GG13982-PA 30..260 27..252 339 34.6 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2014-11-26 16:38:02
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH18802-PA 260 GH18802-PA 4..253 13..257 366 34.8 Plus
Dgri\GH12878-PA 260 GH12878-PA 29..256 27..255 355 35.3 Plus
Dgri\GH17351-PA 260 GH17351-PA 5..249 13..253 351 34.9 Plus
Dgri\GH14934-PA 265 GH14934-PA 1..254 3..253 348 34.7 Plus
Dgri\GH17451-PA 253 GH17451-PA 19..253 27..254 345 34.6 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-26 16:37:56
Subject Length Description Subject Range Query Range Score Percent Strand
CG3640-PA 296 CG3640-PA 1..296 3..298 1596 100 Plus
CG17575-PA 291 CG17575-PA 6..283 9..253 427 34.2 Plus
CG17575-PB 298 CG17575-PB 6..290 9..253 420 33.3 Plus
CG42564-PA 500 CG10284-PA 54..284 27..253 357 34.7 Plus
CG9822-PA 263 CG9822-PA 13..259 13..255 345 33.2 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2014-11-26 16:38:04
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI20220-PA 283 GI20220-PA 11..273 8..253 463 36.9 Plus
Dmoj\GI23890-PA 260 GI23890-PA 1..249 6..253 352 34.2 Plus
Dmoj\GI15744-PA 256 GI15744-PA 23..256 27..254 350 33.9 Plus
Dmoj\Tes33-PA 265 GI23699-PA 1..254 3..253 345 34.6 Plus
Dmoj\Tes104-PA 260 GI22692-PA 4..253 13..257 344 34.8 Plus
Blast to dper-all-translation-r1.3.fasta performed 2014-11-26 16:38:06
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL10234-PA 289 GL10234-PA 7..273 6..273 779 58.9 Plus
Dper\GL17456-PA 291 GL17456-PA 22..284 23..257 429 34.2 Plus
Dper\GL12570-PA 261 GL12570-PA 19..250 27..253 352 36.1 Plus
Dper\GL12032-PA 261 GL12032-PA 19..250 27..253 351 36.1 Plus
Dper\GL11847-PA 263 GL11847-PA 1..257 3..255 348 30.4 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2014-11-26 16:38:08
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA17580-PB 328 GA17580-PB 46..324 6..285 777 56.4 Plus
Dpse\GA17580-PA 289 GA17580-PA 7..285 6..285 775 56.4 Plus
Dpse\GA14563-PA 291 GA14563-PA 22..284 23..257 442 34.6 Plus
Dpse\GA14563-PB 298 GA14563-PB 22..291 23..257 436 33.7 Plus
Dpse\GA23354-PA 263 GA23354-PA 18..259 10..255 358 35.1 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2014-11-26 16:38:10
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM11889-PA 296 GM11889-PA 1..296 3..298 1466 90.5 Plus
Dsec\GM20333-PA 291 GM20333-PA 22..283 25..253 435 35.1 Plus
Dsec\GM10892-PA 512 GM10892-PA 54..296 27..265 349 33.5 Plus
Dsec\GM15726-PA 263 GM15726-PA 13..259 13..255 347 33.2 Plus
Dsec\GM24819-PA 277 GM24819-PA 30..260 27..252 338 33.8 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2014-11-26 16:38:11
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD11888-PA 299 GD11888-PA 1..277 3..280 1377 91.7 Plus
Dsim\GD25810-PA 291 GD25810-PA 22..283 25..253 435 35.1 Plus
Dsim\GD19871-PA 544 GD19871-PA 54..296 27..265 351 33.5 Plus
Dsim\GD25203-PA 263 GD25203-PA 13..259 13..255 347 33.2 Plus
Dsim\GD18744-PA 277 GD18744-PA 3..253 4..253 341 34 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2014-11-26 16:38:13
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ20170-PA 288 GJ20170-PA 22..285 25..260 440 34.8 Plus
Dvir\GJ22322-PA 262 GJ22322-PA 1..261 4..258 365 33 Plus
Dvir\GJ18605-PA 253 GJ18605-PA 20..253 27..254 362 34.3 Plus
Dvir\GJ10116-PA 253 GJ10116-PA 19..253 27..254 351 34.5 Plus
Dvir\GJ24678-PA 261 GJ24678-PA 5..250 13..253 350 36.1 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2014-11-26 16:38:15
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK20884-PA 274 GK20884-PA 15..274 23..260 449 35.8 Plus
Dwil\GK15903-PA 518 GK15903-PA 2..254 1..252 405 36 Plus
Dwil\GK18435-PA 257 GK18435-PA 25..257 27..254 377 35.2 Plus
Dwil\GK14308-PA 260 GK14308-PA 18..255 27..259 357 36.1 Plus
Dwil\GK20747-PA 259 GK20747-PA 6..255 7..250 350 31.9 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2014-11-26 16:38:16
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE14433-PA 296 GE14433-PA 1..294 3..296 1351 84 Plus
Dyak\GE13419-PA 300 GE13419-PA 24..292 25..253 439 34.6 Plus
Dyak\GE13719-PA 263 GE13719-PA 13..259 13..255 342 33.2 Plus
Dyak\GE26087-PA 264 GE26087-PA 3..253 4..253 336 33.2 Plus
Dyak\GE24631-PA 262 GE24631-PA 20..255 27..257 336 34.2 Plus

MIP01849.hyp Sequence

Translation from 2 to 898

> MIP01849.hyp
STMFSIRVWFICLVIVTLNSFPAYSWDYCQEHWCPRSTDHVACNNNGTFG
LDCGREARLIPLSNQLQAFIVHQVNFYRNQVASGGLSAFGPARRMASVRW
DPELAQLAELAAKRCSLSGDGCRNTRRFKHVGQLTGHVIFSAGKHSDLEL
LRHKISNWFGQYMRASKDLQAADPSSNISSFRQLIQESSTHMGCGVLRQR
SHMLWHQQFIVCNFARRNMPREQVYQVGVAATGCRSGRNPRYPNLCALQE
EYDVNAVDRFHSKRPLRIRFKYSASHPSKVLGADRDVAFHPNIKLGRL*

MIP01849.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 15:48:44
Subject Length Description Subject Range Query Range Score Percent Strand
CG3640-PA 296 CG3640-PA 1..296 3..298 1596 100 Plus
CG17575-PA 291 CG17575-PA 6..283 9..253 427 34.2 Plus
CG17575-PB 298 CG17575-PB 6..290 9..253 420 33.3 Plus
CG42564-PA 500 CG10284-PA 54..284 27..253 357 34.7 Plus
CG9822-PA 263 CG9822-PA 13..259 13..255 345 33.2 Plus