Clone MIP02988 Report

Search the DGRC for MIP02988

Clone and Library Details

Library:MIP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by:
Date Registered:2008-10-08
Comments:
Original Plate Number:29
Well:88
Vector:pOT2
Associated Gene/TranscriptCG8786-RC
Protein status:MIP02988.pep: gold
Sequenced Size:3218

Clone Sequence Records

MIP02988.complete Sequence

3218 bp assembled on 2009-04-07

GenBank Submission: BT081990.1

> MIP02988.complete
CTGGTCATACTCAGGCAGCAACAATTTTTTGTTTCAAGTTTGTTTGTGAA
AATTTAAAACTCAACGTCGACGACAACAGCTCGATTTCCCCGCTGTTGAC
GAAATCGATCCAATCCGACCATGTCGCAACAGCGCTCCACAGAGCAGATT
GCAGCTAGCAACAACAACACCAGCGATGTAATAGCGCTGGACGACGACGA
GGATACGGATGTGCAATTCGTTGCAGCTCTGCGTCCCACCGCACCAGTCA
TCGATCTTTGCGTCTCGCCCTCCACTTCTGCTGCTGCTGCTGCGGCGGCG
GCAGCTGCAGCCCACTCAGGAGGCGGAAGTGGCGAGGATCCGGCGGTTGG
ATCCGCATCTGGAGCTGCTGCTTCGGATACCGATTCACTTGCTTCTTCGC
CTGACGAAGGAGCGTTAGCCACCGGTGTGGATGCAGCGGCAGCCGTTTCT
GGCGAAGATTCCCCCTCTGCAGCGGCCGCTGCCTTGGAGTGTCCCATCTG
TTTGCAAACCTGCATCCACCCAGCTCGTCTCCCCTGTGGCCACATCTTCT
GCTTTTTGTGCGTGAAGGGTGTTGCTTATAAGAACCGCCGTTGTGCTATG
TGCCGTCGCGAGATTCCCGCCGAGTTCCTGGACCATCCCCAGCTGGTGAA
TGGCATTGAGGACATCTGCACCACTCGCGCGACCGAGGACGGCTTCCAGT
GGTATTACGAGGGAAGAAACGGTTGGTGGCAGTACGATGACCGCACTAGT
CAGGACATCGAAGATGCCTTTAAGAAGGGCGACAAATCCTGTACAATTTT
GGTAGCCGGCTACGTCTACATTGTGGACTTGGAGCAGCTAGTCCAGCAGC
GCCAGAATGAGCCCACTCGCTGCCGGAGGGTTAAGCGAGACCTAGCCACC
ATACCCAAAAAGGGGGTGGCCGGTCTGCGGATCGAAGGCAACCAGGTGAC
CAGCGACACCGTCTTCAGCAGGCCAACCAACACAGCCAATCCAACCACCG
TGGCAGCAGCTGCCTCCAGTTTCATATCCACCATAGCAGCCACAGATGCG
GCCATTAGAATCGCTAGCGACATAATAGGCTCAACGCTGGCTCATGCAGA
TGAACTAACTCGGGGACTGACGGCTAGCAATCTCAACGATGATCTCAGCA
GCAGCGGTGAGCAATCCAACTCCACAAATTCAAACGATGCAGGGCGCTCG
CCTGCCTCCTCGCCTGCCTCAAGTTCCATGCAGGATCTGATCACGCGTGA
CCTGAGGAACACCCAACAGGTGATTGCCCACAACCAGCACACCATTGATC
TCTTCGAGCAGGCCTTGAACGACTTCCAGGCGCTGGCCATGCGCAACTAT
GTTGACTCCAGCGATGAGGAGAACAACGACCAGGATCAGGAGCATGAGCT
GCGGGAACGGGAGCAGCTGGAGGCGGGCGAGCAGCCACAGTCCAACGATA
ATCCCCAGAGATTTTAGAAATAATCTACTTACCAGAAAGCTTATATTGTT
GCTCGCCTAATCGATACATTTAAAGAAAATATCAAATGTTCCTTTAAGCA
GATTTCGATATACGGAAGGGGAATGTTAACTAGAGAAATGCAGCGCGTAC
CTGAGAATATATCAACTAACATATATAACCATAGGCTCAGAGCGTTGGGC
GTCGAACAGGAAAAATAGAAAAAATAGAAAAGAATGTCTACAGGGTAAAC
AAACATATTCCTTAAAACATAAAATCAGATATTGAAACATAGACGTTACA
GCAGAAACATAAATAATCTATTTAATACGATATTCAATTTTCCCCAAACA
AACTTAACCCAATTAAAGCAAAAAAATGGTATTCTTAGTAGGAAATGGTA
AGGACAGCAGTGGCATTGGTTGAATCCATTTGTGTGGCCTGTAATGCTCT
AAGAAATCTCTGTAAGACCTCCGAATAGGATTTCTCTGAATTAACCTGTA
CATAATAATTACAAAATCAAGAGTTCTACAAGAATTCGGAAAGTTAACCC
TCCCTATGGTCTCATTTGCAAGCTGGCAAAAGTAAATATAAGCTCCTCCA
CCAAGAAAGAGTAGTGTGAAAAAGACAATATTTATGAATTGGGATTAACT
AGACATGTGAGTTCAATTAGCAGGAAGTTCCCACTCACATAATTGATATT
CAGTGCGTTTCTTAAATCGGAATCGTTTAATTTGACTTACTTTCCACAGT
ATCTATGTTCTGACACAGTTTTTAGATTTAAATTAATGCAAGCTGTTTTC
GAAGCGCACTGTCATCAGGGGAATCAGATGCAGTATTAATTATTAAGTCG
CCGTGAAGTGCGTTAAACAAAAACATTTCTGTGACAGTTGAATATATTGA
TATTTTGTATACTCTAAGTTGCTTTAAATAATAGATTTAAAGGAAAATTG
TTAGACAGACCTAATGTTGTATACTACAACTATGTGCTACGGATACGATA
TACGCCCGATTTAATAATCTCAATTTTGTGACTACTATTTATAGATTCGT
TTTCGATATGTACTCCGCCATTACTTCTAACAGCGAAGTGCGTATTCGTT
GCTTCCCTAATATCTACGGTATACCTAAAGCTCTACTGAACCCGACTCCC
GACTTCGAAAAGCCCCTCCTGGTAATATCAACAGCAGTTTTAAAATTAAA
CCTCAAATTGATTTCACCGCAACTCATTGTCAACCTCATAATACTTTCTG
GCATTTTCCATTGCGCATTTTACTGGATTTTGATAACATTTGCTATTCCA
TAACTGACAATGAATGAAATGGTCTTAATTACAATCATTTGCATTGCATA
TCTGGAATACAGAGCCTTTTCGATATGGTTTTCCTATCCTATGGTGGCAG
TTTCTAAACAATTCGATTCGTACTTAATAATCATTTAGCTTTTCAACAAT
TAAATCAAAACCAAATGTGCCAAGAAACATTTATTGAACAGCACTCGCTC
CGGTATTTTTGACAGCACTGATAAGGCAACTCTAATAAACAGCACGTAGC
ATTTTCTGTCGTCTAATATAATTACATTTAATTAATGAATTAAGCATTTA
CAACTTAGTTTATACAAGATGTTAAGTAATAGATATTGCTGAATCCGATA
AATGTCGATTAGAGATCTGGCTTCTGTGCAAGATCACATTTGTAAGAATA
GCTCCTAGGACATGTATTTAAGTTGGGCAATAAAAAAAACCACAAAACCT
TAAAAAAAAAAAAAAAAA

MIP02988.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 21:29:39
Subject Length Description Subject Range Query Range Score Percent Strand
CG8786-RC 3405 CG8786-RC 86..3286 1..3201 16005 100 Plus
CG8786-RB 2046 CG8786-RB 65..1220 1..1156 5780 100 Plus
CG8786-RE 2321 CG8786-RE 28..749 1..722 3610 100 Plus
CG8786-RE 2321 CG8786-RE 1540..2247 2494..3201 3540 100 Plus
CG8786-RB 2046 CG8786-RB 1220..1927 2494..3201 3540 100 Plus
CG8786-RE 2321 CG8786-RE 1106..1540 722..1156 2175 100 Plus
Blast to d_melanogaster_OreR.fa performed 2014-11-27 12:15:17
Subject Length Description Subject Range Query Range Score Percent Strand
chr3L 24539361 chr3L 19627227..19629665 3201..721 11515 98 Minus
chr3L 24539361 chr3L 19631692..19632127 436..1 2150 99.5 Minus
chr3L 24539361 chr3L 19630405..19630562 723..566 775 99.4 Minus
chr3L 24539361 chr3L 19631233..19631366 568..435 670 100 Minus
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 12:15:13
Subject Length Description Subject Range Query Range Score Percent Strand
CG8786-RG 1347 CG8786-PG 1..1347 121..1467 6735 100 Plus
CG8786-RC 1347 CG8786-PC 1..1347 121..1467 6735 100 Plus
CG8786-RB 1131 CG8786-PB 1..1036 121..1156 5180 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 20:01:23 has no hits.
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 12:15:11
Subject Length Description Subject Range Query Range Score Percent Strand
CG8786-RG 3862 CG8786-RG 30..3230 1..3201 16005 100 Plus
CG8786-RC 1667 CG8786-RC 30..1667 1..1638 8190 100 Plus
CG8786-RB 1963 CG8786-RB 30..1185 1..1156 5780 100 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 12:15:16
Subject Length Description Subject Range Query Range Score Percent Strand
CG8786-PG 448 CG8786-PG 1..448 121..1464 1566 100 Plus
CG8786-PC 448 CG8786-PC 1..448 121..1464 1566 100 Plus
CG8786-PB 376 CG8786-PB 1..342 121..1146 1300 100 Plus
CG8786-PF 365 CG8786-PF 1..218 121..771 835 96.8 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 12:15:09
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 19637839..19640319 3201..721 12405 100 Minus
3L 28110227 3L 19642352..19642787 436..1 2180 100 Minus
3L 28110227 3L 19641063..19641220 723..566 790 100 Minus
3L 28110227 3L 19641893..19642026 568..435 670 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:46:16
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28103327 3L 19630939..19633419 3201..721 12405 100 Minus
3L 28103327 3L 19635452..19635887 436..1 2180 100 Minus
3L 28103327 3L 19634163..19634320 723..566 790 100 Minus
3L 28103327 3L 19634993..19635126 568..435 670 100 Minus
Blast to na_te.dros performed 2014-11-27 12:15:10
Subject Length Description Subject Range Query Range Score Percent Strand
rover 7318 rover ROVER 7318bp 4256..4346 2897..2807 139 64.1 Minus
Transpac 5249 Transpac 5249bp Derived from AF222049 (AF222049.1) (Rel. 62, Last updated, Version 1). 3924..4110 2508..2324 116 61.1 Minus

MIP02988.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2014-11-27 13:42:36 Download gff for MIP02988.complete
Subject Subject Range Query Range Percent Splice Strand
chr3L 19631692..19632127 1..436 99   Minus
chr3L 19631234..19631364 437..567 100 <- Minus
chr3L 19630407..19630560 568..721 99 <- Minus
chr3L 19628225..19629664 722..2164 99 <- Minus
chr3L 19627227..19628016 2411..3201 99 == Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2009-10-19 18:08:59 Download gff for MIP02988.complete
Subject Subject Range Query Range Percent Splice Strand
CG8786-RC 1..1347 121..1467 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 21:44:23 Download gff for MIP02988.complete
Subject Subject Range Query Range Percent Splice Strand
CG8786-RC 1..1347 121..1467 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 17:49:32 Download gff for MIP02988.complete
Subject Subject Range Query Range Percent Splice Strand
CG8786-RC 1..1347 121..1467 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 13:42:36 Download gff for MIP02988.complete
Subject Subject Range Query Range Percent Splice Strand
CG8786-RC 1..1347 121..1467 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2009-04-07 17:17:37 Download gff for MIP02988.complete
Subject Subject Range Query Range Percent Splice Strand
CG8786-RC 28..1845 1..1818 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 21:44:23 Download gff for MIP02988.complete
Subject Subject Range Query Range Percent Splice Strand
CG8786-RC 28..1845 1..1818 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:49:32 Download gff for MIP02988.complete
Subject Subject Range Query Range Percent Splice Strand
CG8786-RG 30..3230 1..3201 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 13:42:36 Download gff for MIP02988.complete
Subject Subject Range Query Range Percent Splice Strand
CG8786-RG 30..3230 1..3201 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 13:42:36 Download gff for MIP02988.complete
Subject Subject Range Query Range Percent Splice Strand
3L 19642352..19642787 1..436 100   Minus
3L 19641894..19642024 437..567 100 <- Minus
3L 19641065..19641218 568..721 100 <- Minus
3L 19637839..19640318 722..3201 100 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:49:32 Download gff for MIP02988.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 19635452..19635887 1..436 100   Minus
arm_3L 19634994..19635124 437..567 100 <- Minus
arm_3L 19634165..19634318 568..721 100 <- Minus
arm_3L 19630939..19633418 722..3201 100 <- Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 19:19:29 Download gff for MIP02988.complete
Subject Subject Range Query Range Percent Splice Strand
3L 19635452..19635887 1..436 100   Minus
3L 19634994..19635124 437..567 100 <- Minus
3L 19634165..19634318 568..721 100 <- Minus
3L 19630939..19633418 722..3201 100 <- Minus

MIP02988.pep Sequence

Translation from 120 to 1466

> MIP02988.pep
MSQQRSTEQIAASNNNTSDVIALDDDEDTDVQFVAALRPTAPVIDLCVSP
STSAAAAAAAAAAAHSGGGSGEDPAVGSASGAAASDTDSLASSPDEGALA
TGVDAAAAVSGEDSPSAAAAALECPICLQTCIHPARLPCGHIFCFLCVKG
VAYKNRRCAMCRREIPAEFLDHPQLVNGIEDICTTRATEDGFQWYYEGRN
GWWQYDDRTSQDIEDAFKKGDKSCTILVAGYVYIVDLEQLVQQRQNEPTR
CRRVKRDLATIPKKGVAGLRIEGNQVTSDTVFSRPTNTANPTTVAAAASS
FISTIAATDAAIRIASDIIGSTLAHADELTRGLTASNLNDDLSSSGEQSN
STNSNDAGRSPASSPASSSMQDLITRDLRNTQQVIAHNQHTIDLFEQALN
DFQALAMRNYVDSSDEENNDQDQEHELREREQLEAGEQPQSNDNPQRF*

MIP02988.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2014-11-28 08:32:24
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF10719-PA 356 GF10719-PA 1..327 1..345 1225 75.4 Plus
Blast to dere-all-translation-r1.3.fasta performed 2014-11-28 08:32:25
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG13386-PA 381 GG13386-PA 1..340 1..335 1454 89.4 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2014-11-28 08:32:27
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH14620-PA 401 GH14620-PA 1..363 1..338 1006 61.7 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 08:32:22
Subject Length Description Subject Range Query Range Score Percent Strand
CG8786-PG 448 CG8786-PG 1..448 1..448 2300 100 Plus
CG8786-PC 448 CG8786-PC 1..448 1..448 2300 100 Plus
CG8786-PB 376 CG8786-PB 1..352 1..352 1772 98.6 Plus
CG8786-PF 365 CG8786-PF 1..218 1..217 1096 96.8 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2014-11-28 08:32:28
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI13507-PA 493 GI13507-PA 319..466 201..345 582 85.4 Plus
Dmoj\GI13507-PA 493 GI13507-PA 16..219 6..218 549 58.3 Plus
Blast to dper-all-translation-r1.3.fasta performed 2014-11-28 08:32:30
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL20877-PA 342 GL20877-PA 62..303 105..338 1038 82.2 Plus
Dper\GL25397-PA 110 GL25397-PA 1..71 150..219 317 77.5 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2014-11-28 08:32:31
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA29174-PA 340 GA29174-PA 62..301 107..338 1057 83.8 Plus
Dpse\GA28223-PA 342 GA28223-PA 62..303 105..338 1047 82.6 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2014-11-28 08:32:33
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM17033-PA 381 GM17033-PA 1..339 1..335 1540 95 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2014-11-28 08:32:34
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD12263-PA 501 GD12263-PA 1..223 1..217 938 89.7 Plus
Dsim\GD12263-PA 501 GD12263-PA 326..459 202..335 698 100 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2014-11-28 08:32:36
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ11868-PA 360 GJ11868-PA 1..333 1..345 1140 71.2 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2014-11-28 08:32:37
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK25803-PA 403 GK25803-PA 103..365 111..341 1074 78.7 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2014-11-28 08:32:39
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE22479-PA 497 GE22479-PA 1..220 1..217 864 83.7 Plus
Dyak\GE22479-PA 497 GE22479-PA 323..456 202..335 700 99.3 Plus
Dyak\GE14584-PA 206 GE14584-PA 1..59 160..217 298 88.1 Plus
Dyak\GE22766-PA 79 GE22766-PA 1..79 370..448 297 93.7 Plus

MIP02988.hyp Sequence

Translation from 120 to 1466

> MIP02988.hyp
MSQQRSTEQIAASNNNTSDVIALDDDEDTDVQFVAALRPTAPVIDLCVSP
STSAAAAAAAAAAAHSGGGSGEDPAVGSASGAAASDTDSLASSPDEGALA
TGVDAAAAVSGEDSPSAAAAALECPICLQTCIHPARLPCGHIFCFLCVKG
VAYKNRRCAMCRREIPAEFLDHPQLVNGIEDICTTRATEDGFQWYYEGRN
GWWQYDDRTSQDIEDAFKKGDKSCTILVAGYVYIVDLEQLVQQRQNEPTR
CRRVKRDLATIPKKGVAGLRIEGNQVTSDTVFSRPTNTANPTTVAAAASS
FISTIAATDAAIRIASDIIGSTLAHADELTRGLTASNLNDDLSSSGEQSN
STNSNDAGRSPASSPASSSMQDLITRDLRNTQQVIAHNQHTIDLFEQALN
DFQALAMRNYVDSSDEENNDQDQEHELREREQLEAGEQPQSNDNPQRF*

MIP02988.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:45:40
Subject Length Description Subject Range Query Range Score Percent Strand
CG8786-PG 448 CG8786-PG 1..448 1..448 2300 100 Plus
CG8786-PC 448 CG8786-PC 1..448 1..448 2300 100 Plus
CG8786-PB 376 CG8786-PB 1..352 1..352 1772 98.6 Plus
CG8786-PF 365 CG8786-PF 1..218 1..217 1096 96.8 Plus