Clone MIP03067 Report

Search the DGRC for MIP03067

Clone and Library Details

Library:MIP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by:
Date Registered:2008-10-08
Comments:
Original Plate Number:30
Well:67
Vector:pOT2
Associated Gene/TranscriptCG42393-RA
Protein status:MIP03067.pep: gold
Sequenced Size:1156

Clone Sequence Records

MIP03067.complete Sequence

1156 bp assembled on 2009-01-26

GenBank Submission: BT058056.1

> MIP03067.complete
TCGGCACGAGACAAGTCAGTCGCTCAAAATTTTGTTTCCTTACAAAAAAT
TCACCGTGTTATTGCTCTAATAATTATAAAATATTTTGAAAAATTTAACA
ATGTGTAAATCGTGTGAGGAACAACCAGTTCGGTGCTGCTCAATTTTCTA
TGCCGCTTTCTGCATTTCATGCGGTCTCTTCATGCTCATTTTTTCGATTC
ACAATGTAATACTTTTGAAAAGCTCTATTACAGTCGTGGATTTTTATTTG
CATATGCATGGTGCTGACATGTCTCCCTCAACTTTCCGCATCCTTTACTC
GATGGATGTGATTTTTGCCCTTTCGTACGTCATTGCTGGAACTTTACTAG
CTGTTGGAATCCACCTGAACTCAAAGGGGGTCTTCTTCGCTGGCAAGATC
ATAAGCTATTTCTTTCCAATATATAACATCCTTTATGTATTTCCTTTAAT
TGTGCACATTGCCGCCACAGTGAAATTATGCAGATATCTTAAAGAGAACT
TTAATTAAATTAATTGGATCTAAGCAAGAGCAGTGGACTGGAAGGGATTA
AAATTGACAGCAGGATTATTGAAATATATTATAAAATTTTGGAAAAGATT
TAAGCTATTGCTTGCCGTACAGTTACACTATTTGTTTAAATATTCCTTGT
ACTGCTACTCGATTTTGTGGTGAAATTATTCAGTAAGAAAGAACTTTAAT
AACGGGGCAGATTCGACATTCACTGTGCACAAAACAAGGCTAATACTTCT
TTTATACCATTTTGAAAGAGTCCGCACAAAAATTAAGAACACAGCATATA
TACGCGGTAAAATTATGCTGCATGGAAAAGGAATACGTGTCGTGATCTAC
ATTGAGTGCTCTATAAATCTTAATAAATATTTTTATTGGTCTTAGAAAAG
AAATATCATATTGTCTGCAATATGTTTACATCATTTGTACTTTGTAAAAC
CTAGTCAGCAGTATATGGAAAACGTGGAAATTCGAAGTGACTACGAAACG
AATGGACTAAAATTTGCAATGCAATTCGAAATTTATCAGCAAACAAATTT
AAAACACTTGTCCCGTATCAAGTGAAATATAAATTATCCTAATATAAATA
AAAGGGTTTCCTAGCCGTGTTATGAAACGAGAAAAAAAAAAAAAAAAAAA
AAAAAA

MIP03067.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 21:22:26
Subject Length Description Subject Range Query Range Score Percent Strand
CG42393.a 1655 CG42393.a 109..1231 11..1133 5615 100 Plus
CG42393.b 1777 CG42393.b 109..1231 11..1133 5615 100 Plus
CG42393-RA 1236 CG42393-RA 109..1231 11..1133 5615 100 Plus
Blast to d_melanogaster_OreR.fa performed 2014-11-27 16:08:26
Subject Length Description Subject Range Query Range Score Percent Strand
chr3L 24539361 chr3L 18032448..18032804 11..367 1770 99.7 Plus
chr3L 24539361 chr3L 18033020..18033372 445..797 1750 99.7 Plus
chr3L 24539361 chr3L 18033708..18033908 931..1131 990 99.5 Plus
chr3L 24539361 chr3L 18033428..18033564 798..934 685 100 Plus
chr3L 24539361 chr3L 18032879..18032961 367..449 415 100 Plus
chr3L 24539361 chr3L 18031235..18031337 931..1034 275 86.5 Plus
chr3L 24539361 chr3L 18030477..18030536 389..448 195 88.3 Plus
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 16:08:23
Subject Length Description Subject Range Query Range Score Percent Strand
CG42393-RA 408 CG42393-PA 1..408 101..508 2040 100 Plus
CG32192-RC 402 CG32192-PC 283..401 389..507 235 79.8 Plus
CG32192-RB 411 CG32192-PB 292..410 389..507 235 79.8 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 20:01:34 has no hits.
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 16:08:22
Subject Length Description Subject Range Query Range Score Percent Strand
CG42393-RA 1142 CG42393-RA 22..1142 11..1131 5605 100 Plus
CG32192-RC 983 CG32192-RC 788..889 932..1034 270 86.4 Plus
CG32192-RB 992 CG32192-RB 797..898 932..1034 270 86.4 Plus
CG32192-RC 983 CG32192-RC 386..504 389..507 235 79.8 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 16:08:25
Subject Length Description Subject Range Query Range Score Percent Strand
CG42393-PA 135 CG42393-PA 1..135 101..505 707 100 Plus
CG32192-PB 136 CG32192-PB 3..136 104..505 472 61.2 Plus
CG32192-PC 133 CG32192-PC 3..133 104..505 455 60.4 Plus
CG44163-PA 118 CG44163-PA 8..117 134..502 174 36.6 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 16:08:20
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 18042754..18043110 11..367 1785 100 Plus
3L 28110227 3L 18043326..18043678 445..797 1750 99.7 Plus
3L 28110227 3L 18044014..18044216 931..1133 1000 99.5 Plus
3L 28110227 3L 18043734..18043870 798..934 685 100 Plus
3L 28110227 3L 18043185..18043267 367..449 415 100 Plus
3L 28110227 3L 18041542..18041644 931..1034 260 85.6 Plus
3L 28110227 3L 18040784..18040843 389..448 195 88.3 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:39:31
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28103327 3L 18035854..18036210 11..367 1785 100 Plus
3L 28103327 3L 18036426..18036778 445..797 1750 99.7 Plus
3L 28103327 3L 18037114..18037316 931..1133 1000 99.5 Plus
3L 28103327 3L 18036834..18036970 798..934 685 100 Plus
3L 28103327 3L 18036285..18036367 367..449 415 100 Plus
3L 28103327 3L 18034642..18034744 931..1034 270 85.5 Plus
3L 28103327 3L 18033884..18033943 389..448 195 88.3 Plus
Blast to na_te.dros performed on 2014-11-27 16:08:21 has no hits.

MIP03067.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2014-11-27 17:12:25 Download gff for MIP03067.complete
Subject Subject Range Query Range Percent Splice Strand
chr3L 18033712..18033908 935..1131 100   Plus
chr3L 18033428..18033564 798..934 100 -> Plus
chr3L 18033025..18033372 450..797 100 -> Plus
chr3L 18032880..18032961 368..449 100 -> Plus
chr3L 18032448..18032804 11..367 91 -> Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2009-10-19 18:04:55 Download gff for MIP03067.complete
Subject Subject Range Query Range Percent Splice Strand
CG42393-RA 1..408 101..508 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 21:33:34 Download gff for MIP03067.complete
Subject Subject Range Query Range Percent Splice Strand
CG42393-RA 1..408 101..508 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 18:30:41 Download gff for MIP03067.complete
Subject Subject Range Query Range Percent Splice Strand
CG42393-RA 1..408 101..508 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 17:12:25 Download gff for MIP03067.complete
Subject Subject Range Query Range Percent Splice Strand
CG42393-RA 1..408 101..508 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2009-01-26 14:27:23 Download gff for MIP03067.complete
Subject Subject Range Query Range Percent Splice Strand
CG42393-RA 22..1140 11..1129 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 21:33:34 Download gff for MIP03067.complete
Subject Subject Range Query Range Percent Splice Strand
CG42393-RA 22..1140 11..1129 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 18:30:41 Download gff for MIP03067.complete
Subject Subject Range Query Range Percent Splice Strand
CG42393-RA 22..1142 11..1131 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 17:12:25 Download gff for MIP03067.complete
Subject Subject Range Query Range Percent Splice Strand
CG42393-RA 22..1142 11..1131 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 17:12:25 Download gff for MIP03067.complete
Subject Subject Range Query Range Percent Splice Strand
3L 18044018..18044214 935..1131 100   Plus
3L 18043734..18043870 798..934 100 -> Plus
3L 18043331..18043678 450..797 100 -> Plus
3L 18043186..18043267 368..449 100 -> Plus
3L 18042754..18043110 11..367 100 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 18:30:41 Download gff for MIP03067.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 18037118..18037314 935..1131 100   Plus
arm_3L 18036834..18036970 798..934 100 -> Plus
arm_3L 18036431..18036778 450..797 100 -> Plus
arm_3L 18036286..18036367 368..449 100 -> Plus
arm_3L 18035854..18036210 11..367 100 -> Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 19:06:50 Download gff for MIP03067.complete
Subject Subject Range Query Range Percent Splice Strand
3L 18037118..18037314 935..1131 100   Plus
3L 18036834..18036970 798..934 100 -> Plus
3L 18036431..18036778 450..797 100 -> Plus
3L 18036286..18036367 368..449 100 -> Plus
3L 18035854..18036210 11..367 100 -> Plus

MIP03067.pep Sequence

Translation from 100 to 507

> MIP03067.pep
MCKSCEEQPVRCCSIFYAAFCISCGLFMLIFSIHNVILLKSSITVVDFYL
HMHGADMSPSTFRILYSMDVIFALSYVIAGTLLAVGIHLNSKGVFFAGKI
ISYFFPIYNILYVFPLIVHIAATVKLCRYLKENFN*

MIP03067.pep Blast Records

Blast to dere-all-translation-r1.3.fasta performed 2014-11-26 16:07:16
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG13645-PA 136 GG13645-PA 3..136 2..135 477 62.7 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-26 16:07:13
Subject Length Description Subject Range Query Range Score Percent Strand
CG42393-PA 135 CG42393-PA 1..135 1..135 707 100 Plus
CG32192-PB 136 CG32192-PB 3..136 2..135 472 61.2 Plus
CG32192-PC 133 CG32192-PC 3..133 2..135 455 60.4 Plus
CG44163-PA 118 CG44163-PA 8..117 12..134 174 36.6 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2014-11-26 16:07:22
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM14960-PA 135 GM14960-PA 1..135 1..135 614 85.2 Plus
Dsec\GM14959-PA 136 GM14959-PA 3..136 2..135 461 61.2 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2014-11-26 16:07:23
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD14739-PA 135 GD14739-PA 1..135 1..135 647 90.4 Plus
Dsim\GD14738-PA 141 GD14738-PA 73..141 67..135 210 55.1 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2014-11-26 16:07:26
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE19938-PA 136 GE19938-PA 3..136 2..135 445 61.2 Plus

MIP03067.hyp Sequence

Translation from 100 to 507

> MIP03067.hyp
MCKSCEEQPVRCCSIFYAAFCISCGLFMLIFSIHNVILLKSSITVVDFYL
HMHGADMSPSTFRILYSMDVIFALSYVIAGTLLAVGIHLNSKGVFFAGKI
ISYFFPIYNILYVFPLIVHIAATVKLCRYLKENFN*

MIP03067.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 15:44:28
Subject Length Description Subject Range Query Range Score Percent Strand
CG42393-PA 135 CG42393-PA 1..135 1..135 707 100 Plus
CG32192-PB 136 CG32192-PB 3..136 2..135 472 61.2 Plus
CG32192-PC 133 CG32192-PC 3..133 2..135 455 60.4 Plus
CG44163-PA 118 CG44163-PA 8..117 12..134 174 36.6 Plus