Clone MIP03776 Report

Search the DGRC for MIP03776

Clone and Library Details

Library:MIP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by:
Date Registered:2008-10-08
Comments:
Original Plate Number:37
Well:76
Vector:pOT2
Associated Gene/TranscriptCG13330-RA
Protein status:MIP03776.pep: gold
Sequenced Size:2156

Clone Sequence Records

MIP03776.complete Sequence

2156 bp assembled on 2009-04-03

GenBank Submission: BT081389.1

> MIP03776.complete
ATAAAATCCAATTTATATGATTGGCACGCTAATTTCGAACTCGCATACCT
TGGAAAACTCAAAATTATCAGCCCCAAATGAATCGTATATCGAATCCTTC
GCGTCGCCAGGCGAGTGACGTCTTCATTGGTGACCCCTTCAAAATTCACT
CATACAACTTTCGCTATGCCGACAAGCCATTTTATCCGGTCCAGAACTAT
CAAAGACCTCCGGCGGCACCGACTCCGCCGGCACTGGTGAAGAAGGCCTC
CTTCCAGACCTTCTACCACAATCCCAGATTCAGCCAGGATCCCGAGTACA
TTCCGGCAAAAAAGAGTCCACAAACTAGCTCCTATAGGCGTCGCCTTTTG
CTGGAATCTATGGATATGCCCTTGGGATCTACGGTGACAACGCCGGAGAG
ACAGAGTGTACCGGTGGCTCCGCAGACGAAGCGTTCTCCCACAGCCACGG
ATTCGCCGCTCCTCAGGACATGCTGTCAAAGTGTGCGCTACGAGGCTATG
AGACGGGGTCCAAGCAACACGACTTTGTGCCAGAGTACCACGAATCTCAT
ACGATCAGCTGGCGGCGGTGTGCCTTCTACTTCAACCACCACCTTCTCCA
TGGACTCCAACGCCCATCTGCAGAACAGAAGAAGCGGCTGCGGTATCAGC
ATCGACATCTGCAGTGTGGGTTCGCAATCTGAGGTGGACAACAATGTGAG
CATCCAGATCGCAACGGATGCCTATCTGCTGAACAATACGGACAAGGTGA
GGACCAAGTCCAAACCGGTGCGCTGTACGCCCAGATCCAGCGGCACCTTT
GGCATCGACAAGCGACTGTCCAAGTTCAATGTGAGCGAGACGAAACCTCG
GACGAGTCCGGAATGGGAGCTCCGGCAGAGAGAGAAGGCACGAGAAGCGG
AGCGCCAACAAAAACGGGAGCGGGATCGACAGTTGTTGGAGGACCGACGC
TTGGAGCAGGAGAGGGAACTTCAGGAGGAGCGAGAGCGTGCCCGCCAGCG
GGAGCGAGATCGTGAGCAGCTCCGCCAGTTGGAGCGCATGCGAGATGAGG
AGCGACTCCTAGAGTTGGAAGTGGAGCGCGAGAGGCAGCGATTGCGGGAA
CTAGAGCGGGAAAACCAGCGGCACAGAGAATACGAGCGGCTGTGTGCCCT
CCAGGAGCAGGCGCGTCGGGAGCAAATGGATCTACTGTGCCAAGAGAACA
TACCTCCCCGACCGTCAGTTCCAATGACCTCGCACTTGTACACAACCACC
TCTGATGATCGTTTGCCCGGAATGGCCTTTTGTGATCTATCGTCCCGAAG
GTCACGTCGATTGGAGAATCCGACCAGACCGAAAGAAAGACGGAAGACTA
GAGTATGTCAGGATCCTAGAAGTGTCTCGTCCGCTACCCGTTCACTTACT
CCCCCGCCGATCCTTACCCGGAATAGCAGCTCCCCATCACCCTCTTCAGA
AGCGCCGTCTTCTACACCCACCTCCCGTTCCTCATCTCCAAATCGCAGGT
CAAACCGCTGCTTCAGTTCAACACCTAATCCCGATTCCCAACGATTCCCT
CCTACAATTCCAAGAGATCTAGTTCGCAGTAGTTCGGGAACTTCGAATGG
CAATGTCCATGTCACAGTGACCACCACCGGGCGACGGAGCAACTGCAGCA
TGAGGCGTTCATCCAATGACCGGGCTAGTGAGCAAAAGCAGCTAAATGGA
AACCAAACCTGCGTCGCCTGTCTGAATAATATGCCCATTAGGATAACCAC
ATCTCGGTCCAGGGATACGGATCTAGCCTTCAGTCTGAACCATGTGAGGA
TGAGGGGATCATCACCAGCGCCCACGGAAAGGAGCAGCAGTCAGGAAAGC
CAAGATTCCTGTCAGGTTAACATCAGCGTGTATGCGGATAAACTGCGTTT
GATGCGTTTATAATAATATAAGGGAAAAGTGGGGGATTATATGTGTGATT
TTTGGAACAGATCATCTCTAGAATATAGAGCTAAGCTGTTCCAGAAGACG
CTCATATACTCCCCTAACTTTTCTATATTAGAATAGCGCCAAAATTAGTT
GTATCATTGCTGTTTTTTTGACTTTTAAATGTTCTTAACTAAGCTAAATC
CGAAAATTATATTCCAAACTATAGTTTTTAAAAAAAAAAAAAAAAAAAAA
AAAAAA

MIP03776.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 21:29:00
Subject Length Description Subject Range Query Range Score Percent Strand
CG13330-RA 2123 CG13330-RA 1..2123 1..2123 10615 100 Plus
Vmat-RE 7414 Vmat-RE 3088..5121 2127..94 10170 100 Minus
Vmat-RE 7414 Vmat-RE 5187..5279 93..1 465 100 Minus
Blast to d_melanogaster_OreR.fa performed 2014-11-27 12:13:18
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 9402724..9404757 94..2127 10170 100 Plus
chr2R 21145070 chr2R 9402566..9402658 1..93 465 100 Plus
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 12:13:15
Subject Length Description Subject Range Query Range Score Percent Strand
CG13330-RA 1836 CG13330-PA 1..1836 78..1913 9180 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 20:02:18 has no hits.
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 12:13:13
Subject Length Description Subject Range Query Range Score Percent Strand
CG13330-RA 2129 CG13330-RA 1..2127 1..2127 10635 100 Plus
Vmat-RE 7325 CG33528-RE 3007..5040 2127..94 10170 100 Minus
Vmat-RF 7141 CG33528-RF 2823..4856 2127..94 10170 100 Minus
Vmat-RE 7325 CG33528-RE 5106..5198 93..1 465 100 Minus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 12:13:17
Subject Length Description Subject Range Query Range Score Percent Strand
CG13330-PA 611 CG13330-PA 1..263 78..866 1383 100 Plus
CG13330-PA 611 CG13330-PA 352..611 1131..1910 953 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 12:13:11
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 13515417..13517450 94..2127 10170 100 Plus
2R 25286936 2R 13515259..13515351 1..93 465 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:45:40
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 13516616..13518649 94..2127 10170 100 Plus
2R 25260384 2R 13516458..13516550 1..93 465 100 Plus
Blast to na_te.dros performed on 2014-11-27 12:13:12 has no hits.

MIP03776.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2014-11-27 13:41:59 Download gff for MIP03776.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 9402724..9404759 94..2129 99   Plus
chr2R 9402566..9402658 1..93 100 -> Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2009-10-19 18:08:28 Download gff for MIP03776.complete
Subject Subject Range Query Range Percent Splice Strand
CG13330-RA 1..1836 78..1913 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 21:43:25 Download gff for MIP03776.complete
Subject Subject Range Query Range Percent Splice Strand
CG13330-RA 1..1836 78..1913 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 17:49:19 Download gff for MIP03776.complete
Subject Subject Range Query Range Percent Splice Strand
CG13330-RA 1..1836 78..1913 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 13:41:59 Download gff for MIP03776.complete
Subject Subject Range Query Range Percent Splice Strand
CG13330-RA 1..1836 78..1913 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2009-04-03 15:35:26 Download gff for MIP03776.complete
Subject Subject Range Query Range Percent Splice Strand
CG13330-RA 1..2123 1..2123 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 21:43:25 Download gff for MIP03776.complete
Subject Subject Range Query Range Percent Splice Strand
CG13330-RA 1..2123 1..2123 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:49:19 Download gff for MIP03776.complete
Subject Subject Range Query Range Percent Splice Strand
CG13330-RA 1..2129 1..2129 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 13:41:59 Download gff for MIP03776.complete
Subject Subject Range Query Range Percent Splice Strand
CG13330-RA 1..2129 1..2129 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 13:41:59 Download gff for MIP03776.complete
Subject Subject Range Query Range Percent Splice Strand
2R 13515417..13517452 94..2129 99   Plus
2R 13515259..13515351 1..93 100 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:49:19 Download gff for MIP03776.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 9402922..9404957 94..2129 99   Plus
arm_2R 9402764..9402856 1..93 100 -> Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 19:18:23 Download gff for MIP03776.complete
Subject Subject Range Query Range Percent Splice Strand
2R 13516616..13518651 94..2129 99   Plus
2R 13516458..13516550 1..93 100 -> Plus

MIP03776.pep Sequence

Translation from 77 to 1912

> MIP03776.pep
MNRISNPSRRQASDVFIGDPFKIHSYNFRYADKPFYPVQNYQRPPAAPTP
PALVKKASFQTFYHNPRFSQDPEYIPAKKSPQTSSYRRRLLLESMDMPLG
STVTTPERQSVPVAPQTKRSPTATDSPLLRTCCQSVRYEAMRRGPSNTTL
CQSTTNLIRSAGGGVPSTSTTTFSMDSNAHLQNRRSGCGISIDICSVGSQ
SEVDNNVSIQIATDAYLLNNTDKVRTKSKPVRCTPRSSGTFGIDKRLSKF
NVSETKPRTSPEWELRQREKAREAERQQKRERDRQLLEDRRLEQERELQE
ERERARQRERDREQLRQLERMRDEERLLELEVERERQRLRELERENQRHR
EYERLCALQEQARREQMDLLCQENIPPRPSVPMTSHLYTTTSDDRLPGMA
FCDLSSRRSRRLENPTRPKERRKTRVCQDPRSVSSATRSLTPPPILTRNS
SSPSPSSEAPSSTPTSRSSSPNRRSNRCFSSTPNPDSQRFPPTIPRDLVR
SSSGTSNGNVHVTVTTTGRRSNCSMRRSSNDRASEQKQLNGNQTCVACLN
NMPIRITTSRSRDTDLAFSLNHVRMRGSSPAPTERSSSQESQDSCQVNIS
VYADKLRLMRL*

MIP03776.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2014-11-26 17:36:04
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF13700-PA 694 GF13700-PA 1..694 1..611 1227 49 Plus
Blast to dere-all-translation-r1.3.fasta performed 2014-11-26 17:36:06
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG20387-PA 614 GG20387-PA 1..614 1..611 2415 84.5 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2014-11-26 17:36:08
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH15698-PA 539 GH15698-PA 14..539 8..611 532 34.8 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-26 17:36:00
Subject Length Description Subject Range Query Range Score Percent Strand
CG13330-PA 611 CG13330-PA 1..611 1..611 3161 100 Plus
CG2839-PA 826 CG2839-PA 269..388 245..366 203 35.2 Plus
CG2839-PA 826 CG2839-PA 559..661 264..366 201 39.8 Plus
CG2839-PA 826 CG2839-PA 533..655 244..366 198 34.1 Plus
CG2839-PA 826 CG2839-PA 565..667 264..366 197 38.8 Plus
CG7971-PG 1062 CG7971-PG 491..792 253..594 197 25.4 Plus
CG7971-PA 1062 CG7971-PA 491..792 253..594 197 25.4 Plus
CG7971-PC 1107 CG7971-PC 491..792 253..594 197 25.4 Plus
CG2839-PA 826 CG2839-PA 310..410 264..366 196 41.3 Plus
CG2839-PA 826 CG2839-PA 577..679 264..366 193 37.9 Plus
CG2839-PA 826 CG2839-PA 583..685 264..366 193 37.9 Plus
CG7971-PG 1062 CG7971-PG 392..760 255..592 192 23.9 Plus
CG7971-PA 1062 CG7971-PA 392..760 255..592 192 23.9 Plus
CG2839-PA 826 CG2839-PA 571..673 264..366 191 36.9 Plus
CG2839-PA 826 CG2839-PA 595..697 264..366 186 35 Plus
CG2839-PA 826 CG2839-PA 601..703 264..366 186 35.9 Plus
CG2839-PA 826 CG2839-PA 316..416 264..366 184 36.9 Plus
CG2839-PA 826 CG2839-PA 589..691 264..366 184 35 Plus
CG2839-PA 826 CG2839-PA 274..399 243..366 183 34.9 Plus
CG2839-PA 826 CG2839-PA 531..631 264..366 182 38.8 Plus
CG2839-PA 826 CG2839-PA 613..715 264..366 181 34 Plus
CG2839-PA 826 CG2839-PA 304..404 264..366 180 35.9 Plus
CG2839-PA 826 CG2839-PA 485..625 244..366 177 33.3 Plus
CG2839-PA 826 CG2839-PA 607..708 264..365 174 32.4 Plus
CG2839-PA 826 CG2839-PA 474..589 258..366 170 37.3 Plus
CG2839-PA 826 CG2839-PA 643..750 264..371 169 29.6 Plus
CG2839-PA 826 CG2839-PA 444..554 253..366 168 33.3 Plus
CG2839-PA 826 CG2839-PA 615..721 258..366 168 32.1 Plus
CG2839-PA 826 CG2839-PA 631..733 264..366 167 30.1 Plus
CG2839-PA 826 CG2839-PA 637..748 264..373 167 33 Plus
CG2839-PA 826 CG2839-PA 625..727 264..366 166 30.1 Plus
CG2839-PA 826 CG2839-PA 328..427 264..366 165 34 Plus
CG2839-PA 826 CG2839-PA 352..466 264..366 161 38.3 Plus
CG2839-PA 826 CG2839-PA 346..455 264..373 159 33.3 Plus
CG2839-PA 826 CG2839-PA 318..421 258..366 158 32.1 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2014-11-26 17:36:10
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI18333-PA 381 GI18333-PA 20..379 186..604 334 32.7 Plus
Blast to dper-all-translation-r1.3.fasta performed 2014-11-26 17:36:12
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL27369-PA 318 GL27369-PA 18..316 293..611 486 43.3 Plus
Dper\GL27369-PB 309 GL27369-PB 12..294 10..258 480 45.1 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2014-11-26 17:36:15
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA24816-PA 603 GA24816-PA 5..601 1..611 850 40.4 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2014-11-26 17:36:17
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM21475-PA 247 GM21475-PA 1..247 367..611 978 89.1 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2014-11-26 17:36:18
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD10971-PA 548 GD10971-PA 1..548 1..611 2293 84 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2014-11-26 17:36:20
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ19759-PA 609 GJ19759-PA 13..609 8..611 774 38.9 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2014-11-26 17:36:22
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK15964-PA 426 GK15964-PA 3..426 142..611 391 37.8 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2014-11-26 17:36:24
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE12549-PA 614 GE12549-PA 1..614 1..611 2320 83.1 Plus

MIP03776.hyp Sequence

Translation from 77 to 1912

> MIP03776.hyp
MNRISNPSRRQASDVFIGDPFKIHSYNFRYADKPFYPVQNYQRPPAAPTP
PALVKKASFQTFYHNPRFSQDPEYIPAKKSPQTSSYRRRLLLESMDMPLG
STVTTPERQSVPVAPQTKRSPTATDSPLLRTCCQSVRYEAMRRGPSNTTL
CQSTTNLIRSAGGGVPSTSTTTFSMDSNAHLQNRRSGCGISIDICSVGSQ
SEVDNNVSIQIATDAYLLNNTDKVRTKSKPVRCTPRSSGTFGIDKRLSKF
NVSETKPRTSPEWELRQREKAREAERQQKRERDRQLLEDRRLEQERELQE
ERERARQRERDREQLRQLERMRDEERLLELEVERERQRLRELERENQRHR
EYERLCALQEQARREQMDLLCQENIPPRPSVPMTSHLYTTTSDDRLPGMA
FCDLSSRRSRRLENPTRPKERRKTRVCQDPRSVSSATRSLTPPPILTRNS
SSPSPSSEAPSSTPTSRSSSPNRRSNRCFSSTPNPDSQRFPPTIPRDLVR
SSSGTSNGNVHVTVTTTGRRSNCSMRRSSNDRASEQKQLNGNQTCVACLN
NMPIRITTSRSRDTDLAFSLNHVRMRGSSPAPTERSSSQESQDSCQVNIS
VYADKLRLMRL*

MIP03776.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 14:48:09
Subject Length Description Subject Range Query Range Score Percent Strand
CG13330-PA 611 CG13330-PA 1..611 1..611 3161 100 Plus
CG2839-PA 826 CG2839-PA 269..388 245..366 203 35.2 Plus
CG2839-PA 826 CG2839-PA 559..661 264..366 201 39.8 Plus
CG2839-PA 826 CG2839-PA 533..655 244..366 198 34.1 Plus
CG2839-PA 826 CG2839-PA 565..667 264..366 197 38.8 Plus
CG7971-PG 1062 CG7971-PG 491..792 253..594 197 25.4 Plus
CG7971-PA 1062 CG7971-PA 491..792 253..594 197 25.4 Plus
CG7971-PC 1107 CG7971-PC 491..792 253..594 197 25.4 Plus
CG2839-PA 826 CG2839-PA 310..410 264..366 196 41.3 Plus
CG2839-PA 826 CG2839-PA 577..679 264..366 193 37.9 Plus
CG2839-PA 826 CG2839-PA 583..685 264..366 193 37.9 Plus
CG7971-PG 1062 CG7971-PG 392..760 255..592 192 23.9 Plus
CG7971-PA 1062 CG7971-PA 392..760 255..592 192 23.9 Plus
CG2839-PA 826 CG2839-PA 571..673 264..366 191 36.9 Plus
CG2839-PA 826 CG2839-PA 595..697 264..366 186 35 Plus
CG2839-PA 826 CG2839-PA 601..703 264..366 186 35.9 Plus
CG2839-PA 826 CG2839-PA 316..416 264..366 184 36.9 Plus
CG2839-PA 826 CG2839-PA 589..691 264..366 184 35 Plus
CG2839-PA 826 CG2839-PA 274..399 243..366 183 34.9 Plus
CG2839-PA 826 CG2839-PA 531..631 264..366 182 38.8 Plus
CG2839-PA 826 CG2839-PA 613..715 264..366 181 34 Plus
CG2839-PA 826 CG2839-PA 304..404 264..366 180 35.9 Plus
CG2839-PA 826 CG2839-PA 485..625 244..366 177 33.3 Plus
CG2839-PA 826 CG2839-PA 607..708 264..365 174 32.4 Plus
CG2839-PA 826 CG2839-PA 474..589 258..366 170 37.3 Plus
CG2839-PA 826 CG2839-PA 643..750 264..371 169 29.6 Plus
CG2839-PA 826 CG2839-PA 444..554 253..366 168 33.3 Plus
CG2839-PA 826 CG2839-PA 615..721 258..366 168 32.1 Plus
CG2839-PA 826 CG2839-PA 631..733 264..366 167 30.1 Plus
CG2839-PA 826 CG2839-PA 637..748 264..373 167 33 Plus
CG2839-PA 826 CG2839-PA 625..727 264..366 166 30.1 Plus
CG2839-PA 826 CG2839-PA 328..427 264..366 165 34 Plus
CG2839-PA 826 CG2839-PA 352..466 264..366 161 38.3 Plus
CG2839-PA 826 CG2839-PA 346..455 264..373 159 33.3 Plus
CG2839-PA 826 CG2839-PA 318..421 258..366 158 32.1 Plus