Clone MIP03820 Report

Search the DGRC for MIP03820

Clone and Library Details

Library:MIP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by:
Date Registered:2008-10-08
Comments:
Original Plate Number:38
Well:20
Vector:pOT2
Associated Gene/TranscriptCG33230-RA
Protein status:MIP03820.pep: gold
Sequenced Size:1747

Clone Sequence Records

MIP03820.complete Sequence

1747 bp assembled on 2009-02-10

GenBank Submission: BT058090.1

> MIP03820.complete
AAAACACAGGGACGGTGCGAAAGAAGAGGGATTTTATTTTGTTTTCGCCT
GGCAATTGAGTAATGGCCGGACTCCTTCACCTGACCAAGCAGTGCAGCAT
CCACCTACCCGCCCACTTGGGACGCGCGAAATGCTACACACTCGCTAAGG
GACCGGGAACACACGTGCAGGCAAGAGTGCAAGCATAGAGTTAGACCAAA
ACAGCGCGCACGCACACAGACTTGGAGGATCGATCGGGTATTGGGGACAA
TGGGTCGCACGCAGCGTCGCCGGCATCAGAGGGCCAAGAAGTCTGACGAG
AATTCGGGCTCCCTGCACGACCTCTACGTTCATCTACACTCCGTTGGCTG
GCAGAACCACACTCACTTGTCGGCCCAATACTACGAACAGACAGGTCGAG
GACTATGCTCTAAACAGAAGACCTTTTCTCCGGAGGATGAGCTCATTCGC
CTGCCCATTGGCTGTCTCATAAGCATAGCGACTCTGGAATCTGATGGGCC
ATTCAAAAGTCTTTTCGACGAAGAGTTATTTGACAAGGACTCCAGAATTT
CCTTTCAGGCACTGATAGCCTGTTATATTTTGTACCACAAGCACTTGCAG
GAGTGTACGCTAGGGACTCACTCCTCTACTTACGCTGCATATTTGGACAC
CCTGCCCAGGTGCTACTCCACTCCGTATTTCTGCTCCATACCCGAGCTAC
AGTGTCTGCCAGAATCCCTGCTAGAGCGGACCGTGGCCCAGAACCGTCAG
ATAAGAGGTTACTTTGAAATTATTAAGAACATTGTACACAAATGCGATTG
CTGTGGGAAGAGCTACGGCCAGGAGATTTGGACACTCGCAGACTTTAAGT
GGGCCTACTTCAGCGTGAACACTAGGAGCGTCCACCTCAGTTCCCGCTTT
CTGAAAAAGCAGAGCAACTACTTTCAGCCGCTTATCAGTGGCGACACCAA
CCTGGCATTGGCTCCGTTTCTGGATCTTTTTAACCACTCAGATCAAGTGG
AAATCACAGCAGGGATTGAGGGTCCCGATTACGTTCTTACATTGAAATCT
CTGCCATTTTCCGAGACCAAACCATATGATCAATTGTTCATCAGCTACGG
TGCTTTGCCCAACTTTAAGCTATTGACGGAATATGGCTTTTGGCTAAGAG
AAAATAAGCACGATTACTTTGAAGTCTCCCTACTGGACATTGAGCACATG
ATTAAGCAAAACAAGGAGCTATCAACGCAAACCTTTCACCGGAACATCTT
TAAATTCATCAGGGAGCACAATCTGAACGATCAAATGTTCGTGCACATCG
ACGATGGATGCTCTCACAATCTAAGGGTTGTGCTGCACCTGATCTTCAAG
CAGCAGGCCTACTTTCCCAACATCCTCAACCAGATTGCCTTTGGAGACGC
CGAGCAGTTTCAGGACGTGCAGCCAGAGCTGTCGTACCTCGTAGAATATA
AAATAAAGGAATACGAGATCTTTGGAGGAGAGCTGGATAAGCTTCCTAAA
TTGACAGAAAGTGGTGCAGTGGCACGGTCTTACCTCCAAGAGTGTATCCG
TTACCTCGTTGACTTTCAATCGGTGCATCTAGCTGCATAGAAGCTGTCTA
GGCTGAGCTTAGAATTTAAAACAAGGCGTTTAATATTGAAATGAATAGTA
ATAGATGTTAAAGAAAAACTACTTAAGTTTATATTATTTGAGGCATTTAA
ATTTTTTTTAATAAATCACAGAAAACTGTAAAAAAAAAAAAAAAAAA

MIP03820.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 21:23:00
Subject Length Description Subject Range Query Range Score Percent Strand
CG33230-RA 1648 CG33230-RA 48..1648 1..1601 8005 100 Plus
ABCB7-RB 2662 ABCB7-RB 48..227 1..180 900 100 Plus
ABCB7-RA 2764 ABCB7-RA 48..227 1..180 900 100 Plus
Blast to d_melanogaster_OreR.fa performed 2014-11-27 00:19:45
Subject Length Description Subject Range Query Range Score Percent Strand
chr3L 24539361 chr3L 1618432..1619982 179..1729 7560 99.2 Plus
chr3L 24539361 chr3L 1618025..1618203 1..179 880 99.4 Plus
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 00:19:40
Subject Length Description Subject Range Query Range Score Percent Strand
CG33230-RA 1341 CG33230-PA 1..1341 250..1590 6705 100 Plus
ABCB7-RB 2130 CG7955-PB 1..118 63..180 590 100 Plus
ABCB7-RA 2232 CG7955-PA 1..118 63..180 590 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 20:02:19 has no hits.
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 00:19:39
Subject Length Description Subject Range Query Range Score Percent Strand
CG33230-RA 1754 CG33230-RA 26..1754 1..1729 8645 100 Plus
ABCB7-RB 2387 CG7955-RB 26..205 1..180 900 100 Plus
ABCB7-RA 2743 CG7955-RA 26..205 1..180 900 100 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 00:19:43
Subject Length Description Subject Range Query Range Score Percent Strand
CG33230-PA 446 CG33230-PA 1..446 250..1587 2378 100 Plus
ABCB7-PB 709 CG7955-PB 1..46 63..200 212 91.3 Plus
ABCB7-PA 743 CG7955-PA 1..46 63..200 212 91.3 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 00:19:36
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 1618847..1620400 179..1732 7770 100 Plus
3L 28110227 3L 1618439..1618617 1..179 895 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:40:02
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28103327 3L 1618847..1620400 179..1732 7770 100 Plus
3L 28103327 3L 1618439..1618617 1..179 895 100 Plus
Blast to na_te.dros performed 2014-11-27 00:19:37
Subject Length Description Subject Range Query Range Score Percent Strand
mdg1 7480 mdg1 DMRTMGD1 7480bp Derived from X59545 (g8507) (Rel. 49, Last updated, Version 4). 6867..6955 1714..1630 155 68.5 Minus
Transpac 5249 Transpac 5249bp Derived from AF222049 (AF222049.1) (Rel. 62, Last updated, Version 1). 3891..3926 1647..1682 117 80.6 Plus

MIP03820.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2014-11-27 01:44:42 Download gff for MIP03820.complete
Subject Subject Range Query Range Percent Splice Strand
chr3L 1618433..1619982 180..1729 97   Plus
chr3L 1618025..1618203 1..179 99 -> Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2009-10-19 18:05:28 Download gff for MIP03820.complete
Subject Subject Range Query Range Percent Splice Strand
CG33230-RA 1..1341 250..1590 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 21:34:27 Download gff for MIP03820.complete
Subject Subject Range Query Range Percent Splice Strand
CG33230-RA 1..1341 250..1590 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 06:30:23 Download gff for MIP03820.complete
Subject Subject Range Query Range Percent Splice Strand
CG33230-RA 1..1341 250..1590 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 01:44:42 Download gff for MIP03820.complete
Subject Subject Range Query Range Percent Splice Strand
CG33230-RA 1..1341 250..1590 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2009-02-10 14:23:31 Download gff for MIP03820.complete
Subject Subject Range Query Range Percent Splice Strand
CG33230-RA 48..1648 1..1601 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 21:34:26 Download gff for MIP03820.complete
Subject Subject Range Query Range Percent Splice Strand
CG33230-RA 48..1648 1..1601 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 06:30:23 Download gff for MIP03820.complete
Subject Subject Range Query Range Percent Splice Strand
CG33230-RA 26..1754 1..1729 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 01:44:42 Download gff for MIP03820.complete
Subject Subject Range Query Range Percent Splice Strand
CG33230-RA 26..1754 1..1729 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 01:44:42 Download gff for MIP03820.complete
Subject Subject Range Query Range Percent Splice Strand
3L 1618848..1620397 180..1729 100   Plus
3L 1618439..1618617 1..179 100 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 06:30:23 Download gff for MIP03820.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 1618848..1620397 180..1729 100   Plus
arm_3L 1618439..1618617 1..179 100 -> Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 19:07:48 Download gff for MIP03820.complete
Subject Subject Range Query Range Percent Splice Strand
3L 1618848..1620397 180..1729 100   Plus
3L 1618439..1618617 1..179 100 -> Plus

MIP03820.pep Sequence

Translation from 249 to 1589

> MIP03820.pep
MGRTQRRRHQRAKKSDENSGSLHDLYVHLHSVGWQNHTHLSAQYYEQTGR
GLCSKQKTFSPEDELIRLPIGCLISIATLESDGPFKSLFDEELFDKDSRI
SFQALIACYILYHKHLQECTLGTHSSTYAAYLDTLPRCYSTPYFCSIPEL
QCLPESLLERTVAQNRQIRGYFEIIKNIVHKCDCCGKSYGQEIWTLADFK
WAYFSVNTRSVHLSSRFLKKQSNYFQPLISGDTNLALAPFLDLFNHSDQV
EITAGIEGPDYVLTLKSLPFSETKPYDQLFISYGALPNFKLLTEYGFWLR
ENKHDYFEVSLLDIEHMIKQNKELSTQTFHRNIFKFIREHNLNDQMFVHI
DDGCSHNLRVVLHLIFKQQAYFPNILNQIAFGDAEQFQDVQPELSYLVEY
KIKEYEIFGGELDKLPKLTESGAVARSYLQECIRYLVDFQSVHLAA*

MIP03820.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2014-11-26 16:19:56
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF10426-PA 449 GF10426-PA 1..443 1..443 1754 73.5 Plus
Blast to dere-all-translation-r1.3.fasta performed 2014-11-26 16:19:57
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG14807-PA 1183 GG14807-PA 50..486 1..437 2224 91.3 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2014-11-26 16:19:58
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH16622-PA 455 GH16622-PA 1..452 1..446 1557 65.8 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-26 16:19:55
Subject Length Description Subject Range Query Range Score Percent Strand
CG33230-PA 446 CG33230-PA 1..446 1..446 2378 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2014-11-26 16:20:00
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI12469-PA 1097 GI12469-PA 1..431 1..424 1454 63.2 Plus

MIP03820.hyp Sequence

Translation from 249 to 1589

> MIP03820.hyp
MGRTQRRRHQRAKKSDENSGSLHDLYVHLHSVGWQNHTHLSAQYYEQTGR
GLCSKQKTFSPEDELIRLPIGCLISIATLESDGPFKSLFDEELFDKDSRI
SFQALIACYILYHKHLQECTLGTHSSTYAAYLDTLPRCYSTPYFCSIPEL
QCLPESLLERTVAQNRQIRGYFEIIKNIVHKCDCCGKSYGQEIWTLADFK
WAYFSVNTRSVHLSSRFLKKQSNYFQPLISGDTNLALAPFLDLFNHSDQV
EITAGIEGPDYVLTLKSLPFSETKPYDQLFISYGALPNFKLLTEYGFWLR
ENKHDYFEVSLLDIEHMIKQNKELSTQTFHRNIFKFIREHNLNDQMFVHI
DDGCSHNLRVVLHLIFKQQAYFPNILNQIAFGDAEQFQDVQPELSYLVEY
KIKEYEIFGGELDKLPKLTESGAVARSYLQECIRYLVDFQSVHLAA*

MIP03820.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:49:14
Subject Length Description Subject Range Query Range Score Percent Strand
CG33230-PA 446 CG33230-PA 1..446 1..446 2378 100 Plus