Clone MIP03872 Report

Search the DGRC for MIP03872

Clone and Library Details

Library:MIP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by:
Date Registered:2008-10-08
Comments:
Original Plate Number:38
Well:72
Vector:pOT2
Associated Gene/TranscriptCG4653-RA
Protein status:MIP03872.pep: gold
Sequenced Size:814

Clone Sequence Records

MIP03872.complete Sequence

814 bp assembled on 2009-02-09

GenBank Submission: BT058066.1

> MIP03872.complete
ACAAGCCATGAGTCCGGTTCAGTCATATTCACACAGTCGACTACTCCTGC
TCGTGGTCATCGTGACCTTGGGCGTGGTCCAATCCAGTCGACTGCCGGCG
GAGGTGGGCTCCCAGCCACACAGCATCTCACTGCGTCGGAATGGCGTCCA
TGTGTGCGGAGGAGCTTTGATCCGTGAAAAGTGGATCCTCACCGCAGCCC
ATTGCGTCAGTTTGGGCGGTGGACAGCAGAGCTACCCAGCTAAATCCTAC
AATGTGCGAGTGGGCAGCATTCAGCGACTGACCGGTGGTCAACTGGTGCC
TCTGTCCAAGATCATAATCCACACGAACTACTCCAGTTCGGATGCAGTTG
GCTCTAATGACTTGGCCTTGCTGGAGCTGGAAACGTCGGTGGTCCTGAAT
GCGAATACGAATCCGATTGATTTGGCCACCGAGCGACCGGCGGCGGGCTC
CCAGATTATCTTCTCCGGCTGGGGATCCAGCCAGGTGGACGGATCTCTCA
GTCATGTCCTCCAGGTGGCCACCAGACAGAGCCTGAGTGCGTCCGATTGC
CAAACGGAGCTGTACCTGCAGCAGGAGGATCTGCTCTGTTTGTCCCCGGT
GGACGAGGACTTCGCCGGACTCTGTTCCGGTGATGCCGGAGCTCCGGCGT
CTTACAACAACCAATTGGTGGGCATTGCCGCCTTCTTTGTGAGCGGATGT
GGTTCCGAGCAGCCCGATGGCTACGTGGATGTGACCCAGCATCTGGAGTG
GATTAACGAAAACGCTGTTTAAATAAAACCGAGACGTTGATTAGGGAAAA
AAAAAAAAAAAAAA

MIP03872.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 21:22:57
Subject Length Description Subject Range Query Range Score Percent Strand
CG4653-RA 1062 CG4653-RA 16..814 1..799 3995 100 Plus
Blast to d_melanogaster_OreR.fa performed 2014-11-27 08:46:51
Subject Length Description Subject Range Query Range Score Percent Strand
chrX 22417052 chrX 16594266..16594832 230..796 2835 100 Plus
chrX 22417052 chrX 16593734..16593964 1..231 1155 100 Plus
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 08:46:48
Subject Length Description Subject Range Query Range Score Percent Strand
CG4653-RA 765 CG4653-PA 1..765 8..772 3825 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 20:02:30 has no hits.
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 08:46:46
Subject Length Description Subject Range Query Range Score Percent Strand
CG4653-RA 895 CG4653-RA 1..796 1..796 3980 100 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 08:46:50
Subject Length Description Subject Range Query Range Score Percent Strand
CG4653-PA 254 CG4653-PA 1..254 8..769 1227 100 Plus
CG1304-PA 260 CG1304-PA 44..257 116..766 433 40.9 Plus
Ser6-PA 259 CG2071-PA 44..257 116..766 422 41.2 Plus
CG9676-PA 251 CG9676-PA 34..249 98..766 413 40.3 Plus
CG32523-PA 262 CG32523-PA 41..260 92..766 368 36.1 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 08:46:43
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 16704613..16705182 230..799 2850 100 Plus
X 23542271 X 16704081..16704311 1..231 1155 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:39:59
Subject Length Description Subject Range Query Range Score Percent Strand
X 23527363 X 16712711..16713280 230..799 2850 100 Plus
X 23527363 X 16712179..16712409 1..231 1155 100 Plus
Blast to na_te.dros performed on 2014-11-27 08:46:44 has no hits.

MIP03872.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2014-11-27 10:08:29 Download gff for MIP03872.complete
Subject Subject Range Query Range Percent Splice Strand
chrX 16594268..16594832 232..796 100   Plus
chrX 16593734..16593964 1..231 100 -> Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2009-10-19 18:05:24 Download gff for MIP03872.complete
Subject Subject Range Query Range Percent Splice Strand
CG4653-RA 1..765 8..772 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 21:34:22 Download gff for MIP03872.complete
Subject Subject Range Query Range Percent Splice Strand
CG4653-RA 1..765 8..772 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 08:00:50 Download gff for MIP03872.complete
Subject Subject Range Query Range Percent Splice Strand
CG4653-RA 1..765 8..772 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 10:08:29 Download gff for MIP03872.complete
Subject Subject Range Query Range Percent Splice Strand
CG4653-RA 1..765 8..772 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2009-02-09 13:46:59 Download gff for MIP03872.complete
Subject Subject Range Query Range Percent Splice Strand
CG4653-RA 1..765 8..772 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 21:34:21 Download gff for MIP03872.complete
Subject Subject Range Query Range Percent Splice Strand
CG4653-RA 1..765 8..772 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 08:00:50 Download gff for MIP03872.complete
Subject Subject Range Query Range Percent Splice Strand
CG4653-RA 1..796 1..796 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 10:08:29 Download gff for MIP03872.complete
Subject Subject Range Query Range Percent Splice Strand
CG4653-RA 1..796 1..796 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 10:08:29 Download gff for MIP03872.complete
Subject Subject Range Query Range Percent Splice Strand
X 16704615..16705179 232..796 100   Plus
X 16704081..16704311 1..231 100 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 08:00:50 Download gff for MIP03872.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 16598648..16599212 232..796 100   Plus
arm_X 16598114..16598344 1..231 100 -> Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 19:07:42 Download gff for MIP03872.complete
Subject Subject Range Query Range Percent Splice Strand
X 16712713..16713277 232..796 100   Plus
X 16712179..16712409 1..231 100 -> Plus

MIP03872.hyp Sequence

Translation from 0 to 771

> MIP03872.hyp
QAMSPVQSYSHSRLLLLVVIVTLGVVQSSRLPAEVGSQPHSISLRRNGVH
VCGGALIREKWILTAAHCVSLGGGQQSYPAKSYNVRVGSIQRLTGGQLVP
LSKIIIHTNYSSSDAVGSNDLALLELETSVVLNANTNPIDLATERPAAGS
QIIFSGWGSSQVDGSLSHVLQVATRQSLSASDCQTELYLQQEDLLCLSPV
DEDFAGLCSGDAGAPASYNNQLVGIAAFFVSGCGSEQPDGYVDVTQHLEW
INENAV*

MIP03872.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:20:41
Subject Length Description Subject Range Query Range Score Percent Strand
CG4653-PA 254 CG4653-PA 1..254 3..256 1295 100 Plus
CG1304-PA 260 CG1304-PA 44..257 39..255 433 40.9 Plus
Ser6-PA 259 CG2071-PA 44..257 39..255 422 41.2 Plus
CG9676-PA 251 CG9676-PA 34..249 33..255 413 40.3 Plus
CG32523-PA 262 CG32523-PA 41..260 31..255 368 36.1 Plus

MIP03872.pep Sequence

Translation from 1 to 771

> MIP03872.pep
QAMSPVQSYSHSRLLLLVVIVTLGVVQSSRLPAEVGSQPHSISLRRNGVH
VCGGALIREKWILTAAHCVSLGGGQQSYPAKSYNVRVGSIQRLTGGQLVP
LSKIIIHTNYSSSDAVGSNDLALLELETSVVLNANTNPIDLATERPAAGS
QIIFSGWGSSQVDGSLSHVLQVATRQSLSASDCQTELYLQQEDLLCLSPV
DEDFAGLCSGDAGAPASYNNQLVGIAAFFVSGCGSEQPDGYVDVTQHLEW
INENAV*

MIP03872.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2014-11-26 16:18:47
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF22653-PA 252 GF22653-PA 20..250 26..254 899 74 Plus
Dana\GF21864-PA 264 GF21864-PA 13..258 14..251 388 37.8 Plus
Dana\GF22295-PA 255 GF22295-PA 38..253 33..255 367 35.1 Plus
Dana\GF17863-PA 269 GF17863-PA 38..252 36..254 319 34.5 Plus
Dana\GF21865-PA 229 GF21865-PA 60..224 85..255 318 38.6 Plus
Blast to dere-all-translation-r1.3.fasta performed 2014-11-26 16:18:49
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG19067-PA 255 GG19067-PA 1..255 3..256 1097 85.5 Plus
Dere\GG17565-PA 260 GG17565-PA 44..257 39..255 420 40.5 Plus
Dere\GG18232-PA 251 GG18232-PA 34..249 33..255 397 38.4 Plus
Dere\GG17566-PA 259 GG17566-PA 44..257 39..255 380 38.9 Plus
Dere\GG16791-PA 267 GG16791-PA 33..250 33..254 322 34.9 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2014-11-26 16:18:51
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH12394-PA 251 GH12394-PA 33..250 33..254 580 50.7 Plus
Dgri\GH24521-PA 256 GH24521-PA 36..253 33..254 413 39.3 Plus
Dgri\GH12388-PA 269 GH12388-PA 46..263 33..255 344 36.4 Plus
Dgri\GH14253-PA 260 GH14253-PA 28..244 33..253 337 35.4 Plus
Dgri\GH12384-PA 235 GH12384-PA 16..230 33..251 325 33.6 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-26 16:18:46
Subject Length Description Subject Range Query Range Score Percent Strand
CG4653-PA 254 CG4653-PA 1..254 3..256 1295 100 Plus
CG1304-PA 260 CG1304-PA 44..257 39..255 433 40.9 Plus
Ser6-PA 259 CG2071-PA 44..257 39..255 422 41.2 Plus
CG9676-PA 251 CG9676-PA 34..249 33..255 413 40.3 Plus
CG32523-PA 262 CG32523-PA 41..260 31..255 368 36.1 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2014-11-26 16:18:52
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI14724-PA 252 GI14724-PA 19..251 22..254 626 52.5 Plus
Dmoj\GI15881-PA 254 GI15881-PA 39..252 39..255 430 40.5 Plus
Dmoj\GI15500-PA 257 GI15500-PA 35..254 33..255 351 38.5 Plus
Dmoj\GI15882-PA 268 GI15882-PA 49..266 33..255 317 35.9 Plus
Dmoj\GI15879-PA 258 GI15879-PA 34..256 33..254 315 35.5 Plus
Blast to dper-all-translation-r1.3.fasta performed 2014-11-26 16:18:53
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL26856-PA 294 GL26856-PA 18..162 26..171 531 67.8 Plus
Dper\GL26774-PA 255 GL26774-PA 38..253 33..255 365 37.1 Plus
Dper\GL27215-PA 268 GL27215-PA 34..252 33..254 319 36 Plus
Dper\GL17140-PA 237 GL17140-PA 11..223 34..253 298 34.8 Plus
Dper\GL26772-PA 261 GL26772-PA 40..260 39..255 292 34.3 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2014-11-26 16:18:55
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA18331-PA 249 GA18331-PA 18..248 26..255 864 69.8 Plus
Dpse\GA21958-PA 255 GA21958-PA 38..253 33..255 367 37.1 Plus
Dpse\GA14523-PA 268 GA14523-PA 5..252 13..254 332 35.8 Plus
Dpse\GA11993-PA 220 GA11993-PA 52..218 83..255 320 39.7 Plus
Dpse\GA11574-PA 269 GA11574-PA 43..255 34..253 298 34.8 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2014-11-26 16:18:56
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM13457-PA 254 GM13457-PA 1..254 3..256 1154 91.3 Plus
Dsec\GM22650-PA 259 GM22650-PA 44..257 39..255 405 41.6 Plus
Dsec\GM22649-PA 260 GM22649-PA 44..257 39..255 394 40.9 Plus
Dsec\GM13375-PA 251 GM13375-PA 34..249 33..255 392 38.9 Plus
Dsec\GM15384-PA 267 GM15384-PA 33..250 33..254 324 35.7 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2014-11-26 16:18:57
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD17298-PA 254 GD17298-PA 1..254 3..256 1163 92.1 Plus
Dsim\GD15730-PA 251 GD15730-PA 34..249 33..255 407 39.8 Plus
Dsim\GD15519-PA 259 GD15519-PA 44..257 39..255 402 41.6 Plus
Dsim\GD15518-PA 260 GD15518-PA 44..257 39..255 394 40.9 Plus
Dsim\GD17523-PA 262 GD17523-PA 43..260 33..255 332 36 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2014-11-26 16:18:59
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ19438-PA 252 GJ19438-PA 1..251 3..254 625 49 Plus
Dvir\GJ18708-PA 253 GJ18708-PA 32..251 33..255 447 42 Plus
Dvir\GJ18895-PA 256 GJ18895-PA 40..250 39..252 422 41.5 Plus
Dvir\GJ19257-PA 272 GJ19257-PA 56..265 39..251 383 42.1 Plus
Dvir\GJ18709-PA 265 GJ18709-PA 41..258 33..255 339 36.4 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2014-11-26 16:19:00
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK25410-PA 246 GK25410-PA 2..245 3..255 737 54.1 Plus
Dwil\GK25506-PA 256 GK25506-PA 35..254 33..255 425 39.8 Plus
Dwil\GK20044-PA 258 GK20044-PA 43..256 39..255 345 39.4 Plus
Dwil\GK10885-PA 274 GK10885-PA 41..257 33..253 319 34.5 Plus
Dwil\GK25505-PA 254 GK25505-PA 36..250 33..253 318 33 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2014-11-26 16:19:02
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE17612-PA 255 GE17612-PA 1..255 3..256 1100 87.1 Plus
Dyak\GE15326-PA 259 GE15326-PA 44..257 39..255 424 40 Plus
Dyak\GE15325-PA 260 GE15325-PA 44..257 39..255 423 40.9 Plus
Dyak\GE15651-PA 253 GE15651-PA 36..251 33..255 392 38.9 Plus
Dyak\GE15648-PA 252 GE15648-PA 33..250 36..254 302 31.7 Plus