Clone MIP03953 Report

Search the DGRC for MIP03953

Clone and Library Details

Library:MIP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by:
Date Registered:2008-10-08
Comments:
Original Plate Number:39
Well:53
Vector:pOT2
Associated Gene/TranscriptMkp-RA
Protein status:MIP03953.pep: gold
Sequenced Size:1600

Clone Sequence Records

MIP03953.complete Sequence

1600 bp assembled on 2009-09-15

GenBank Submission: BT099769.1

> MIP03953.complete
GTTGTGGGTCGTGCTCTATAACATGTATAGGTATTTGTTGAACATTTCTT
ACATCGGCACGACTTTTCGTAACCGTAACTTTCAGAACAGACGCCGGTGT
ACACGCCCTGCACTCCACGGTGCAGGTGGACTTGGAGCGGCCTAATGGGC
AGCCCTATGATACAACTATATTAACTGGTGTGCTCAACCGAACCCTTAAC
AAACAGCGTCTTCCCATCCGAGTGCTCAGCAGTAAGTTGGTGGCCAACTC
CTTCCACTGCCGCTACGACGCCATTGGACGAACCTATCTCTATCGCTTTG
CCGTGGCAAAGGTACCAACCCTGGGAGATTGCAGTCTCCGGAATAGGTCG
TTCGAGACCTTTATACCAGTTGAAGAAATCGATCGTTGTTACTTTCTGCA
ATCTTCTAGCTTCGATATCAAAAGAGTCCAGGCTGCAGCTCGAATGTTTA
TCGGCGTCCACGACTTTCGAACTTTCATGAGTGTTAGCCGACAGAAAGTT
TGTCGGGATCACCCAATGTTTACAGTGCGCAAAATCGACGAGATTAATAT
TCGTCCTGGTGAAACACGTGCATTGTCTTCGAACGCTATTCAGGCCGCTG
AAACATATAATTATTGGGACATCGAGATCAGGGCTAAATCATTTCTTTAC
AAACAAGTAAGGCGCATTGTCGGCGCGCTAATCGCTTTGGGTAACGGACG
TATCGACGAGAGGTGCCTATATCAGATGCTCACCGTTCCCTCGAAGAATT
CTTGGGATCACCGTGTGCTCCTGGCTCCAGCCTGTGGGCTTTACCTTTGC
AGAGTGCACTACCGAGAAACGGACATTTAATACCGCTATGATACTGCTGT
ATGAGCTGCAAAGGCGAATGGGCAACCTGAGACCCACCGCCACGGTTGTG
ACCACCCCCACCGGTGTACGCTACATTGAGCGAAGCACTTCATCCGTCTG
CGTGGAGGACATTGCGCACTGCTCCCAGCAACTGGATCCGCGTGAATACG
GCTTTGTCGTGGATACCAAGCCGGACTCTGTGCCCGCCTGCATTCTGAGC
GACTTTCTCTACCTGGGCTCGCAGGATGCAGTTAGCGCGGATAACATCAT
AAAATATAAGATAACTCACATCCTGAGTGTCGGCATACAGACGCCCGAGG
TGGAGTGGCCCTTACCCGTAAATTGTACATTTTTGCCCTGCCTGGATCTG
CCGGAAACCAACCTGATGAACTACATCTTGCCCGCGTCAATGGAGTTTAT
TGAAGATGCGCACAGATCGCAGGGTTGCGTGCTCGTCCACTGCAACGCAG
GCGTTTCGCGATCCCCCTCTGTGGTAATCGGTTATTTAATGCAGCGCCGT
GACATGTGCTACGAAGATGCATACAATCTGGTAAAATCATGGAGACCGTG
TATTCAGCCCAATGCGGGATTCATACAACAGTTAAAGAGGTCTGATTAAT
AGTTTATGATACTGCATATGATAAGTAATTATGAATGTTGTTCTGTTTTT
TGTTTGTGGGTTTTAGTTACTAATCCACATTTGTTGTACAACACAACGAT
ATTATCCACTAAACTCTCAAGTTTTAAACATAAAAAAAAAAAAAAAAAAA

MIP03953.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 16:39:43
Subject Length Description Subject Range Query Range Score Percent Strand
Mkp-RB 1730 Mkp-RB 234..1730 85..1581 7485 100 Plus
CG34140-RA 1730 CG34140-RA 234..1730 85..1581 7485 100 Plus
Mkp-RA 1181 Mkp-RA 1..1181 401..1581 5905 100 Plus
Mkp-RB 1730 Mkp-RB 37..106 1..70 350 100 Plus
CG34140-RA 1730 CG34140-RA 37..106 1..70 350 100 Plus
Blast to d_melanogaster_OreR.fa performed 2014-11-27 09:39:51
Subject Length Description Subject Range Query Range Score Percent Strand
chr3L 24539361 chr3L 182484..183664 1581..401 5905 100 Minus
chr3L 24539361 chr3L 183720..184051 400..69 1660 100 Minus
chr3L 24539361 chr3L 184280..184348 69..1 345 100 Minus
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 09:39:48
Subject Length Description Subject Range Query Range Score Percent Strand
CG34140-RA 921 CG34140-PA 176..921 85..830 3730 100 Plus
Mkp-RC 612 CG34099-PC 1..612 838..1449 3060 100 Plus
Mkp-RD 612 CG34099-PD 1..612 838..1449 3060 100 Plus
CG34140-RA 921 CG34140-PA 1..48 23..70 240 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 20:02:36 has no hits.
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 09:39:46
Subject Length Description Subject Range Query Range Score Percent Strand
Mkp-RD 1603 CG34099-RD 39..1603 1..1581 7630 99 Plus
Mkp-RB 1732 CG34099-RB 236..1732 85..1581 7485 100 Plus
CG34140-RA 1730 CG34140-RA 234..1730 85..1581 7485 100 Plus
Mkp-RB 1732 CG34099-RB 39..108 1..70 350 100 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 09:39:50
Subject Length Description Subject Range Query Range Score Percent Strand
CG34140-PA 306 CG34140-PA 46..306 45..827 1297 95.4 Plus
Mkp-PC 203 CG34099-PC 1..203 838..1446 1017 100 Plus
Mkp-PD 203 CG34099-PD 1..203 838..1446 1017 100 Plus
Mkp-PB 203 CG34099-PB 1..203 838..1446 1017 100 Plus
Mkp-PA 203 CG34099-PA 1..203 838..1446 1017 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 09:39:43
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 182514..183702 1589..401 5930 99.9 Minus
3L 28110227 3L 183758..184089 400..69 1660 100 Minus
3L 28110227 3L 184318..184386 69..1 345 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 18:36:56
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28103327 3L 182514..183702 1589..401 5930 99.9 Minus
3L 28103327 3L 183758..184089 400..69 1660 100 Minus
3L 28103327 3L 184318..184386 69..1 345 100 Minus
Blast to na_te.dros performed on 2014-11-27 09:39:45 has no hits.

MIP03953.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2014-11-27 11:25:50 Download gff for MIP03953.complete
Subject Subject Range Query Range Percent Splice Strand
chr3L 184280..184348 1..69 100   Minus
chr3L 183720..184050 70..400 100 <- Minus
chr3L 182484..183664 401..1581 100 <- Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2009-10-19 17:54:36 Download gff for MIP03953.complete
Subject Subject Range Query Range Percent Splice Strand
CG34140-RA 1..49 23..75 92 -> Plus
CG34140-RA 174..921 76..830 99   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 14:12:35 Download gff for MIP03953.complete
Subject Subject Range Query Range Percent Splice Strand
CG34140-RA 174..921 76..830 99   Plus
CG34140-RA 1..49 23..75 92 -> Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 16:31:17 Download gff for MIP03953.complete
Subject Subject Range Query Range Percent Splice Strand
CG34140-RA 174..921 76..830 99   Plus
CG34140-RA 1..49 23..75 92 -> Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 11:25:50 Download gff for MIP03953.complete
Subject Subject Range Query Range Percent Splice Strand
CG34140-RA 174..921 76..830 99   Plus
CG34140-RA 1..49 23..75 92 -> Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2009-09-15 18:16:51 Download gff for MIP03953.complete
Subject Subject Range Query Range Percent Splice Strand
Mkp-RB 37..107 1..75 94 -> Plus
Mkp-RB 232..1730 76..1581 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 14:12:35 Download gff for MIP03953.complete
Subject Subject Range Query Range Percent Splice Strand
CG34140-RA 232..1730 76..1581 99   Plus
CG34140-RA 37..107 1..75 94 -> Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 16:31:17 Download gff for MIP03953.complete
Subject Subject Range Query Range Percent Splice Strand
CG34140-RA 232..1730 76..1581 99   Plus
CG34140-RA 37..107 1..75 94 -> Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 11:25:50 Download gff for MIP03953.complete
Subject Subject Range Query Range Percent Splice Strand
Mkp-RD 107..1603 85..1581 100   Plus
Mkp-RD 39..106 1..68 100 == Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 11:25:50 Download gff for MIP03953.complete
Subject Subject Range Query Range Percent Splice Strand
3L 184318..184386 1..69 100   Minus
3L 183758..184088 70..400 100 <- Minus
3L 182522..183702 401..1581 100 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 16:31:17 Download gff for MIP03953.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 184318..184386 1..69 100   Minus
arm_3L 183758..184088 70..400 100 <- Minus
arm_3L 182522..183702 401..1581 100 <- Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 12:03:28 Download gff for MIP03953.complete
Subject Subject Range Query Range Percent Splice Strand
3L 184318..184386 1..69 100   Minus
3L 183758..184088 70..400 100 <- Minus
3L 182522..183702 401..1581 100 <- Minus

MIP03953.pep Sequence

Translation from 837 to 1448

> MIP03953.pep
MILLYELQRRMGNLRPTATVVTTPTGVRYIERSTSSVCVEDIAHCSQQLD
PREYGFVVDTKPDSVPACILSDFLYLGSQDAVSADNIIKYKITHILSVGI
QTPEVEWPLPVNCTFLPCLDLPETNLMNYILPASMEFIEDAHRSQGCVLV
HCNAGVSRSPSVVIGYLMQRRDMCYEDAYNLVKSWRPCIQPNAGFIQQLK
RSD*

MIP03953.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2014-11-28 08:45:53
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF24925-PA 203 GF24925-PA 1..201 1..202 750 72.3 Plus
Dana\GF20412-PA 374 GF20412-PA 16..170 50..200 220 34.6 Plus
Dana\GF10784-PA 461 GF10784-PA 217..355 63..200 193 33.6 Plus
Dana\GF16724-PA 491 GF16724-PA 137..267 66..199 190 35.1 Plus
Dana\GF16206-PA 225 GF16206-PA 64..177 89..201 181 33.9 Plus
Blast to dere-all-translation-r1.3.fasta performed 2014-11-28 08:45:54
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG25359-PA 499 GG25359-PA 297..499 1..203 924 87.7 Plus
Dere\GG19239-PA 385 GG19239-PA 44..172 74..200 211 37.5 Plus
Dere\GG23159-PA 486 GG23159-PA 135..265 66..199 191 35.1 Plus
Dere\GG11968-PA 227 GG11968-PA 47..179 70..201 189 33.6 Plus
Dere\GG13428-PA 411 GG13428-PA 212..349 63..199 185 32.4 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2014-11-28 08:45:56
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH25313-PA 496 GH25313-PA 291..492 1..201 757 73.8 Plus
Dgri\GH24414-PA 369 GH24414-PA 35..169 63..200 211 37.4 Plus
Dgri\GH16949-PA 425 GH16949-PA 236..363 74..200 197 37.2 Plus
Dgri\GH12630-PA 385 GH12630-PA 66..193 74..200 195 38 Plus
Dgri\GH18324-PA 487 GH18324-PA 92..225 63..199 192 34.3 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 08:45:52
Subject Length Description Subject Range Query Range Score Percent Strand
Mkp-PC 203 CG34099-PC 1..203 1..203 1078 100 Plus
Mkp-PD 203 CG34099-PD 1..203 1..203 1078 100 Plus
Mkp-PB 203 CG34099-PB 1..203 1..203 1078 100 Plus
Mkp-PA 203 CG34099-PA 1..203 1..203 1078 100 Plus
MKP-4-PC 387 CG14211-PC 46..174 74..200 209 38.2 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2014-11-28 08:45:57
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI24889-PA 499 GI24889-PA 299..495 1..201 740 70.1 Plus
Dmoj\GI16231-PA 396 GI16231-PA 36..164 74..200 219 41.9 Plus
Dmoj\GI11809-PA 419 GI11809-PA 230..357 74..200 187 37.2 Plus
Dmoj\GI23305-PA 455 GI23305-PA 88..215 66..196 182 34.4 Plus
Dmoj\GI23389-PA 246 GI23389-PA 66..197 70..200 174 35.3 Plus
Blast to dper-all-translation-r1.3.fasta performed 2014-11-28 08:45:58
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL16086-PA 504 GL16086-PA 300..501 1..202 784 73.3 Plus
Dper\GL21927-PA 410 GL21927-PA 211..348 63..199 190 33.8 Plus
Dper\GL24256-PA 489 GL24256-PA 131..264 63..199 185 34.1 Plus
Dper\GL13480-PA 237 GL13480-PA 76..189 89..201 170 33.9 Plus
Dper\GL20791-PA 305 GL20791-PA 12..136 74..200 162 31.2 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2014-11-28 08:45:59
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA20054-PA 504 GA20054-PA 300..501 1..202 784 73.3 Plus
Dpse\GA12826-PA 380 GA12826-PA 13..166 51..200 221 35.4 Plus
Dpse\GA12750-PA 410 GA12750-PA 211..348 63..199 190 33.8 Plus
Dpse\GA20632-PA 489 GA20632-PA 131..264 63..199 187 33.6 Plus
Dpse\GA13785-PA 237 GA13785-PA 57..189 70..201 171 32.6 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2014-11-28 08:46:01
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM14299-PA 499 GM14299-PA 297..499 1..203 992 95.1 Plus
Dsec\GM22974-PA 388 GM22974-PA 46..174 74..200 216 38.2 Plus
Dsec\GM12185-PA 212 GM12185-PA 32..164 70..201 196 35.1 Plus
Dsec\GM23703-PA 478 GM23703-PA 133..263 66..199 191 35.1 Plus
Dsec\GM14895-PA 411 GM14895-PA 212..349 63..199 186 32.4 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2014-11-28 08:46:02
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD13536-PA 499 GD13536-PA 297..499 1..203 982 94.6 Plus
Dsim\GD17377-PA 233 GD17377-PA 53..185 70..201 196 35.1 Plus
Dsim\GD18513-PA 482 GD18513-PA 133..263 66..199 191 35.1 Plus
Dsim\GD12305-PA 411 GD12305-PA 212..349 63..199 186 32.4 Plus
Dsim\GD18249-PA 1247 GD18249-PA 389..516 72..200 176 35.6 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2014-11-28 08:46:03
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ12898-PA 513 GJ12898-PA 312..509 1..201 744 72.6 Plus
Dvir\GJ15922-PA 374 GJ15922-PA 11..165 50..200 220 37.6 Plus
Dvir\GJ13512-PA 417 GJ13512-PA 228..355 74..200 194 36.4 Plus
Dvir\GJ24161-PA 513 GJ24161-PA 133..263 66..199 192 35.1 Plus
Dvir\GJ22910-PA 1192 GJ22910-PA 404..531 72..200 178 36.4 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2014-11-28 08:46:04
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK25867-PA 508 GK12492-PA 293..495 1..201 689 68.3 Plus
Dwil\GK25725-PA 385 GK25725-PA 50..178 74..200 232 41.9 Plus
Dwil\GK12504-PA 432 GK12504-PA 232..370 63..200 195 34.3 Plus
Dwil\GK14377-PA 529 GK14377-PA 124..257 63..199 189 34.3 Plus
Dwil\GK13421-PA 257 GK13421-PA 77..208 70..200 169 33.1 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2014-11-28 08:46:06
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE26463-PA 495 GE21044-PA 293..495 1..203 939 89.2 Plus
Dyak\GE15858-PA 385 GE15858-PA 19..172 51..200 221 35.4 Plus
Dyak\GE23417-PA 200 GE23417-PA 20..152 70..201 190 34.3 Plus
Dyak\GE25849-PA 479 GE25849-PA 133..263 66..199 190 35.1 Plus
Dyak\GE22784-PA 279 GE22784-PA 80..217 63..199 186 32.4 Plus

MIP03953.hyp Sequence

Translation from 837 to 1448

> MIP03953.hyp
MILLYELQRRMGNLRPTATVVTTPTGVRYIERSTSSVCVEDIAHCSQQLD
PREYGFVVDTKPDSVPACILSDFLYLGSQDAVSADNIIKYKITHILSVGI
QTPEVEWPLPVNCTFLPCLDLPETNLMNYILPASMEFIEDAHRSQGCVLV
HCNAGVSRSPSVVIGYLMQRRDMCYEDAYNLVKSWRPCIQPNAGFIQQLK
RSD*

MIP03953.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:46:17
Subject Length Description Subject Range Query Range Score Percent Strand
Mkp-PC 203 CG34099-PC 1..203 1..203 1078 100 Plus
Mkp-PD 203 CG34099-PD 1..203 1..203 1078 100 Plus
Mkp-PB 203 CG34099-PB 1..203 1..203 1078 100 Plus
Mkp-PA 203 CG34099-PA 1..203 1..203 1078 100 Plus
MKP-4-PC 387 CG14211-PC 46..174 74..200 209 38.2 Plus