Clone MIP04093 Report

Search the DGRC for MIP04093

Clone and Library Details

Library:MIP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by:
Date Registered:2008-10-08
Comments:
Original Plate Number:40
Well:93
Vector:pOT2
Associated Gene/TranscriptSpn77Bb-RA
Protein status:MIP04093.pep: gold
Sequenced Size:1180

Clone Sequence Records

MIP04093.complete Sequence

1180 bp assembled on 2009-05-14

GenBank Submission: BT058072.1

> MIP04093.complete
GTGCACAAAGAGCCAAGTAAATTTTGTTGACAATATGAAGCTCGGATTTC
TGGGGCTTTTTGGCATGGTGCTCATGATCATGTTCTACGAGGGAGCAGAA
GGGTATACCGTCAATGAGCTGCGCGATGTCCTGGGGATCTATGTCGATTA
TCCAACACTGCGCAGGTGGTACGAGGATGTCCGAGCTTATCACTATTTAA
ATTCGGAAAACACAAAACTGTTTTCGCTGCGTTACGCTTACTACGACGAC
GTAGGAGATTTAGAACTCGTGAAAGGGTACAACAGTGTAGTCCTAGAAGG
AGTAGGAGAAGGAAATGTGGTTCTTCGAGAGGGTCGGCCAAGGGGTGTGG
ACTTCGACCAGGGGGCGAGTATAATAATCAACGACGATATCGACAAAGCC
TCTCATGCGAAAATCTTCAGTTCTTATAGCCGTCGTTCGTTCAATAGTAC
AGTAACTGTGCTGGGGATTACTGTTAGCTACTTTAAGGCCAAATGGAAGT
ATCCATTCGATAAGTCCCAGACGAAAGTGGAACAGTTTTACAACGACGGC
GGCTCGCCGGCAGGTAAGGTGGAGATGATGGTGCAAACGGGGAAGTATGC
CTACGTCAATAATGTAAAGGGTCTGCAAGCGGATGTCCTGGAGCTACCTT
TTGGGGAACATGAGCTAGTAATGATCGTCTTACTGCCGAAGTCATCCCAG
GGAGTTAACCTGGTGCTCTACCAATTGAAGAACCTGGGACTACATCGCCT
CCTTGAGAAACTCGAGGCCTCCAAGAATGAAACTGATGTAGAAGTCAAGC
TTCCCAAGTTCGATACGCGATCCGTACTTTCACTCGAAGATACCGTATAT
GACGCTGGACTAACGGATCTGAGGAACGACTTCGCAGATCTAGATAAATT
GCTGATTGCTATCGGTCACAGAGGTGCGTGCCTCACCCTCTACCACCAAT
TCGCCAGGATCGTCGTAGATGAAGAGGGTTTGCCTAATGCTGTTCCGCAG
AAGTCTTCTGGAAAAAATAACATCAAGTTCCATGTAAACAGGCCGTTTGC
ATACCTTGTCCTACAAAAGAAACACAAATTGCTCATTCACTCCGGAGTCT
TTCGGGAAGGTGAGATCCAGTAATGAAGATAAGCAGAAAATACATTGGTT
TTTTCTATGACAAAAAAAAAAAAAAAAAAA

MIP04093.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 16:26:32
Subject Length Description Subject Range Query Range Score Percent Strand
CG6663-RA 1113 CG6663-RA 1..1113 11..1123 5565 100 Plus
CG6289-RA 1370 CG6289-RA 234..1324 74..1164 4750 95.6 Plus
CG6289-RA 1370 CG6289-RA 9..72 11..74 260 93.7 Plus
Blast to d_melanogaster_OreR.fa performed 2014-11-27 07:44:15
Subject Length Description Subject Range Query Range Score Percent Strand
chr3L 24539361 chr3L 20310741..20311097 498..854 1785 100 Plus
chr3L 24539361 chr3L 20332567..20332923 498..854 1590 96.4 Plus
chr3L 24539361 chr3L 20311154..20311461 854..1161 1540 100 Plus
chr3L 24539361 chr3L 20332198..20332501 196..499 1475 99 Plus
chr3L 24539361 chr3L 20310372..20310675 196..499 1445 98.4 Plus
chr3L 24539361 chr3L 20332980..20333287 854..1161 1210 92.9 Plus
chr3L 24539361 chr3L 20310120..20310304 11..195 925 100 Plus
chr3L 24539361 chr3L 20332009..20332130 74..195 475 92.6 Plus
chr3L 24539361 chr3L 20331784..20331847 11..74 260 93.8 Plus
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 07:44:10
Subject Length Description Subject Range Query Range Score Percent Strand
Spn77Bb-RA 1089 CG6663-PA 1..1089 35..1123 5445 100 Plus
Spn77Bc-RB 1251 CG6289-PB 202..1251 74..1123 4560 95.6 Plus
Spn77Bc-RA 1251 CG6289-PA 202..1251 74..1123 4560 95.6 Plus
Spn77Bc-RB 1251 CG6289-PB 1..40 35..74 185 97.5 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 20:02:47 has no hits.
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 07:44:09
Subject Length Description Subject Range Query Range Score Percent Strand
Spn77Bb-RA 1161 CG6663-RA 1..1161 1..1161 5805 100 Plus
Spn77Bc-RB 1430 CG6289-RB 241..1328 74..1161 4735 95.7 Plus
Spn77Bc-RA 1440 CG6289-RA 251..1338 74..1161 4735 95.7 Plus
Spn77Bc-RB 1430 CG6289-RB 6..79 1..74 310 94.6 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 07:44:13
Subject Length Description Subject Range Query Range Score Percent Strand
Spn77Bb-PA 362 CG6663-PA 18..362 86..1120 1684 100 Plus
Spn77Bc-PB 416 CG6289-PB 72..416 86..1120 1540 91.9 Plus
Spn77Bc-PA 416 CG6289-PA 72..416 86..1120 1540 91.9 Plus
Spn77Ba-PC 450 CG6680-PC 113..445 86..1105 389 32.2 Plus
Spn77Ba-PB 450 CG6680-PB 113..445 86..1105 389 32.2 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 07:44:06
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 20321638..20321994 498..854 1785 100 Plus
3L 28110227 3L 20343497..20343851 498..852 1610 96.9 Plus
3L 28110227 3L 20322051..20322361 854..1164 1555 100 Plus
3L 28110227 3L 20321269..20321572 196..499 1520 100 Plus
3L 28110227 3L 20343128..20343431 196..499 1490 99.3 Plus
3L 28110227 3L 20343910..20344220 854..1164 1225 92.9 Plus
3L 28110227 3L 20321017..20321201 11..195 925 100 Plus
3L 28110227 3L 20342939..20343060 74..195 445 91 Plus
3L 28110227 3L 20342714..20342777 11..74 260 93.8 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 18:20:58
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28103327 3L 20314738..20315094 498..854 1785 100 Plus
3L 28103327 3L 20336597..20336951 498..852 1610 96.9 Plus
3L 28103327 3L 20315151..20315461 854..1164 1555 100 Plus
3L 28103327 3L 20314369..20314672 196..499 1520 100 Plus
3L 28103327 3L 20336228..20336531 196..499 1490 99.3 Plus
3L 28103327 3L 20337010..20337320 854..1164 1225 92.9 Plus
3L 28103327 3L 20314117..20314301 11..195 925 100 Plus
3L 28103327 3L 20336039..20336160 74..195 445 90.9 Plus
3L 28103327 3L 20335814..20335877 11..74 260 93.7 Plus
Blast to na_te.dros performed on 2014-11-27 07:44:07 has no hits.

MIP04093.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2014-11-27 09:56:07 Download gff for MIP04093.complete
Subject Subject Range Query Range Percent Splice Strand
chr3L 20311154..20311461 854..1161 100   Plus
chr3L 20310743..20311096 500..853 100 -> Plus
chr3L 20310372..20310675 196..499 98 -> Plus
chr3L 20310120..20310304 11..195 100 -> Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2009-10-19 18:05:10 Download gff for MIP04093.complete
Subject Subject Range Query Range Percent Splice Strand
CG6663-RA 1..1089 35..1123 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 13:52:21 Download gff for MIP04093.complete
Subject Subject Range Query Range Percent Splice Strand
Spn77Bb-RA 1..1089 35..1123 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 10:12:31 Download gff for MIP04093.complete
Subject Subject Range Query Range Percent Splice Strand
Spn77Bb-RA 1..1089 35..1123 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 09:56:07 Download gff for MIP04093.complete
Subject Subject Range Query Range Percent Splice Strand
Spn77Bb-RA 1..1089 35..1123 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2009-02-05 15:49:17 Download gff for MIP04093.complete
Subject Subject Range Query Range Percent Splice Strand
CG6663-RA 1..1113 11..1123 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 13:52:20 Download gff for MIP04093.complete
Subject Subject Range Query Range Percent Splice Strand
Spn77Bb-RA 1..1113 11..1123 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 10:12:31 Download gff for MIP04093.complete
Subject Subject Range Query Range Percent Splice Strand
Spn77Bb-RA 1..1161 1..1161 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 09:56:07 Download gff for MIP04093.complete
Subject Subject Range Query Range Percent Splice Strand
Spn77Bb-RA 1..1161 1..1161 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 09:56:07 Download gff for MIP04093.complete
Subject Subject Range Query Range Percent Splice Strand
3L 20322051..20322358 854..1161 100   Plus
3L 20321640..20321993 500..853 100 -> Plus
3L 20321269..20321572 196..499 100 -> Plus
3L 20321017..20321201 11..195 100 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 10:12:31 Download gff for MIP04093.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 20315151..20315458 854..1161 100   Plus
arm_3L 20314740..20315093 500..853 100 -> Plus
arm_3L 20314369..20314672 196..499 100 -> Plus
arm_3L 20314117..20314301 11..195 100 -> Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 11:43:09 Download gff for MIP04093.complete
Subject Subject Range Query Range Percent Splice Strand
3L 20315151..20315458 854..1161 100   Plus
3L 20314740..20315093 500..853 100 -> Plus
3L 20314369..20314672 196..499 100 -> Plus
3L 20314117..20314301 11..195 100 -> Plus

MIP04093.pep Sequence

Translation from 1 to 1122

> MIP04093.pep
CTKSQVNFVDNMKLGFLGLFGMVLMIMFYEGAEGYTVNELRDVLGIYVDY
PTLRRWYEDVRAYHYLNSENTKLFSLRYAYYDDVGDLELVKGYNSVVLEG
VGEGNVVLREGRPRGVDFDQGASIIINDDIDKASHAKIFSSYSRRSFNST
VTVLGITVSYFKAKWKYPFDKSQTKVEQFYNDGGSPAGKVEMMVQTGKYA
YVNNVKGLQADVLELPFGEHELVMIVLLPKSSQGVNLVLYQLKNLGLHRL
LEKLEASKNETDVEVKLPKFDTRSVLSLEDTVYDAGLTDLRNDFADLDKL
LIAIGHRGACLTLYHQFARIVVDEEGLPNAVPQKSSGKNNIKFHVNRPFA
YLVLQKKHKLLIHSGVFREGEIQ*

MIP04093.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2014-11-28 09:24:04
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF10328-PA 446 GF10328-PA 104..441 24..368 383 31.2 Plus
Dana\GF19634-PA 394 GF19634-PA 63..322 23..303 229 28.5 Plus
Dana\GF11691-PA 374 GF11691-PA 47..370 29..367 215 24.3 Plus
Dana\GF19633-PA 329 GF19633-PA 1..314 25..353 201 25.7 Plus
Dana\GF15866-PA 371 GF15866-PA 43..356 23..353 198 25.3 Plus
Blast to dere-all-translation-r1.3.fasta performed 2014-11-28 09:24:06
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG16101-PA 450 GG16101-PA 108..445 24..368 408 32.3 Plus
Dere\GG21843-PA 374 GG21843-PA 47..370 29..367 209 24 Plus
Dere\GG23229-PA 401 GG23229-PA 45..365 25..353 204 25.3 Plus
Dere\GG23495-PA 321 GG23495-PA 17..293 23..326 191 28.8 Plus
Dere\GG10790-PA 424 GG10790-PA 153..410 114..368 189 24.8 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2014-11-28 09:24:07
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH14729-PA 445 GH14729-PA 103..437 24..365 397 33.2 Plus
Dgri\GH20251-PA 377 GH20251-PA 120..370 114..367 228 27.6 Plus
Dgri\GH22013-PA 401 GH22013-PA 45..368 24..357 202 25.3 Plus
Dgri\GH19862-PA 382 GH19862-PA 53..374 31..361 199 25.2 Plus
Dgri\GH20377-PA 408 GH20377-PA 151..325 116..290 153 27.1 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 09:24:03
Subject Length Description Subject Range Query Range Score Percent Strand
Spn77Bb-PA 362 CG6663-PA 1..362 12..373 1869 100 Plus
Spn77Bc-PB 416 CG6289-PB 67..416 24..373 1664 92 Plus
Spn77Bc-PA 416 CG6289-PA 67..416 24..373 1664 92 Plus
Spn77Ba-PC 450 CG6680-PC 108..445 24..368 407 32.4 Plus
Spn77Ba-PB 450 CG6680-PB 108..445 24..368 407 32.4 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2014-11-28 09:24:09
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI13382-PA 445 GI13382-PA 103..440 24..368 407 34.2 Plus
Dmoj\Acp48-PA 401 GI14552-PA 122..386 75..355 217 28.5 Plus
Dmoj\GI19420-PA 376 GI19420-PA 41..370 23..367 215 23 Plus
Dmoj\GI19810-PA 401 GI19810-PA 53..381 31..368 188 25.4 Plus
Dmoj\GI11773-PA 405 GI11773-PA 66..390 5..353 182 25.8 Plus
Blast to dper-all-translation-r1.3.fasta performed 2014-11-28 09:24:10
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL25131-PA 438 GL25131-PA 106..433 24..368 333 29.3 Plus
Dper\GL10534-PA 376 GL10534-PA 47..370 29..367 221 24.6 Plus
Dper\GL10964-PA 379 GL10964-PA 117..370 111..361 191 25.1 Plus
Dper\GL11125-PA 404 GL11125-PA 44..365 24..353 173 23.8 Plus
Dper\GL21686-PA 422 GL21686-PA 72..416 25..369 170 24.9 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2014-11-28 09:24:11
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA23694-PA 448 GA23694-PA 106..443 24..368 362 30.1 Plus
Dpse\GA10637-PA 376 GA10637-PA 47..370 29..367 225 24.6 Plus
Dpse\GA24617-PA 375 GA24617-PA 49..364 27..357 195 27.2 Plus
Dpse\GA24549-PA 379 GA24549-PA 117..370 111..361 188 25.1 Plus
Dpse\GA24618-PA 407 GA24618-PA 69..375 25..349 169 24 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2014-11-28 09:24:12
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM22274-PA 374 GM22274-PA 24..374 24..373 1224 66.6 Plus
Dsec\GM22276-PA 235 GM22276-PA 67..222 24..179 731 85.3 Plus
Dsec\GM22277-PA 150 GM22277-PA 1..150 224..373 571 74.7 Plus
Dsec\GM22272-PA 450 GM22272-PA 108..445 24..368 402 31.8 Plus
Dsec\GM11939-PA 341 GM11939-PA 45..324 25..308 209 26.4 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2014-11-28 09:24:14
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD14875-PA 416 GD14875-PA 67..415 24..372 1478 79.4 Plus
Dsim\GD14874-PA 324 GD14874-PA 24..278 24..278 848 64.6 Plus
Dsim\GD14873-PA 450 GD14873-PA 108..445 24..368 402 31.8 Plus
Dsim\GD22457-PA 348 GD22457-PA 19..341 20..368 222 26.1 Plus
Dsim\GD10430-PA 403 GD10430-PA 45..324 25..308 212 26.4 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2014-11-28 09:24:15
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ11505-PA 445 GJ11505-PA 103..440 24..368 391 31.5 Plus
Dvir\GJ22484-PA 376 GJ22484-PA 118..370 112..367 224 27 Plus
Dvir\GJ23351-PA 348 GJ23351-PA 80..328 116..361 179 23.6 Plus
Dvir\GJ17545-PA 407 GJ17545-PA 122..323 111..308 179 26.9 Plus
Dvir\GJ18486-PA 377 GJ18486-PA 53..373 31..365 159 25 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2014-11-28 09:24:16
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK16950-PA 444 GK16950-PA 102..439 24..368 416 32.5 Plus
Dwil\GK16951-PA 412 GK16951-PA 77..404 24..365 363 29.9 Plus
Dwil\GK22245-PA 374 GK22245-PA 41..370 23..367 204 23.6 Plus
Dwil\GK20886-PA 391 GK20886-PA 148..380 126..358 203 26.9 Plus
Dwil\GK20757-PA 332 GK20757-PA 58..324 108..361 194 25.7 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2014-11-28 09:24:18
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE19662-PA 436 GE19662-PA 81..436 24..373 880 51.7 Plus
Dyak\GE19664-PA 450 GE19664-PA 108..445 24..368 412 32 Plus
Dyak\GE19661-PA 439 GE19661-PA 97..434 24..368 411 32 Plus
Dyak\GE18323-PA 400 GE18323-PA 74..393 27..373 215 26.8 Plus
Dyak\GE19665-PA 290 GE19665-PA 178..290 266..373 213 42.2 Plus
Dyak\GE19665-PA 290 GE19665-PA 81..200 24..166 202 34.3 Plus

MIP04093.hyp Sequence

Translation from 11 to 1122

> MIP04093.hyp
SQVNFVDNMKLGFLGLFGMVLMIMFYEGAEGYTVNELRDVLGIYVDYPTL
RRWYEDVRAYHYLNSENTKLFSLRYAYYDDVGDLELVKGYNSVVLEGVGE
GNVVLREGRPRGVDFDQGASIIINDDIDKASHAKIFSSYSRRSFNSTVTV
LGITVSYFKAKWKYPFDKSQTKVEQFYNDGGSPAGKVEMMVQTGKYAYVN
NVKGLQADVLELPFGEHELVMIVLLPKSSQGVNLVLYQLKNLGLHRLLEK
LEASKNETDVEVKLPKFDTRSVLSLEDTVYDAGLTDLRNDFADLDKLLIA
IGHRGACLTLYHQFARIVVDEEGLPNAVPQKSSGKNNIKFHVNRPFAYLV
LQKKHKLLIHSGVFREGEIQ*

MIP04093.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 15:49:45
Subject Length Description Subject Range Query Range Score Percent Strand
Spn77Bb-PA 362 CG6663-PA 1..362 9..370 1869 100 Plus
Spn77Bc-PB 416 CG6289-PB 67..416 21..370 1664 92 Plus
Spn77Bc-PA 416 CG6289-PA 67..416 21..370 1664 92 Plus
Spn77Ba-PC 450 CG6680-PC 108..445 21..365 407 32.4 Plus
Spn77Ba-PB 450 CG6680-PB 108..445 21..365 407 32.4 Plus