Clone MIP04163 Report

Search the DGRC for MIP04163

Clone and Library Details

Library:MIP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by:
Date Registered:2008-10-08
Comments:
Original Plate Number:41
Well:63
Vector:pOT2
Associated Gene/TranscriptMitf-RC
Protein status:MIP04163.pep: gold
Sequenced Size:3246

Clone Sequence Records

MIP04163.complete Sequence

3246 bp assembled on 2009-05-14

GenBank Submission: BT082107.1

> MIP04163.complete
CCAAGATCAAGGTCTTTAAAATACTCTAAATAGTTTACCGACTGTTAACA
AGAATGTTTTCTTACTGGACCAAACAGAATATATCAAGCTCAGTAGATGG
AAAAAAGATGGACAAAGTTTCTACCATGAGAAAAAAAAATTCAACAAAAG
TTAAAATGGAGAAAAAAGAAACAGTTGTACCGATTACAGAAATGCGTGCT
CTGGAATTTCAAGATTTCCTTAAGCGGGTACAGACGTTACAAATGTCGCA
CAACGAAAGCCGCGATTTAGTCAATGGACCTAATATCTGCAGTTCCATGG
ATATTGAAGTCGGCGAAGAACCTCCTACGACATCTTTTGCCGATAACATA
GATAAAGCGTGTCCTTTACCAGTGCTGCGATCATCTGATTGTGATTGTGT
GCCACTTTGTATGACAAATATTCGTGTATCAGTTGGTATTGACAAAGACT
TAGAAATGATTCTTGAAATGGATCCGAGTATTGTAGATTTGGGTGATATT
AGCATTGATGAAACTGCAGAACCGCGCATAGTGGGCTTACCTCCACTTTC
GGGTGGACCGACATTTAAAACTGCTACTCCCACTTCACGAACACAACTAA
AACTGCAGCTACAACGTGAACAACAGCAACAAATGATGATACAACAACAG
ACATTAGACACTGCTATGGACCCAAAAATGCATCTATTGTTTGGCAGTGG
GCAGGGGCTTATGGAATCGGAATTCATTGACAGCGGTAGTACCAGTGCTT
GTGGCAGCGGGTCATCCAGTTTAGAACAAATGTCACAGTTAGTGCAAATG
GACAATTTAATTGATTCGTCAAGTGGAGCCAAGCTTAAAGTTCCTCTTCA
AAGTATCGGAGTAGATGTGCCACCCCAAGTGCTGCAGGTCAGTACAGTGC
TTGAAAACCCTACAAGGTATCACGTTATCCAAAAGCAAAAGAATCAAGTG
AGGCAATATCTCAGCGAATCCTTTAAGCCGTCTATGTGGGGCAGTCATAC
CAGCGAAATAAAATTAGCAAATAATTCTGCGTCAACGGGAAATCTTCAAA
ATTCATCTTTACAGAAAGGTATTTGCGATCCATTGGAGCGTACAAACCGA
TTTGGATGCGATTCGGCTGTGAGTGCTAAAAGAATTATGCCTTCCGATGA
CGCAATGCCTATTTCCCCATTCGGTGGTAGTTTTGTACGATGTGATGACA
TAAATCCAATTGAGCCAACTGTATTACGACCTAATAGTCATGGTGCTGGG
GAACCAGAAAATGCACATAGAACGGCCCAGTTGGGACTTAGTAAAGCTAA
TTCAAGCCTAAGTTCAACGCGTTCTTCTTCAGGGATTGTTAATTCAATTC
GAATTTCCAGTACATCAAGCTCGTTACAGTCTACCTCAGCTCCTATTTCG
CCGAGCGTAAGTTCGGTTGCAACGAGTGTCTCTGAGCCAGATGACATCTT
CGATGATATATTACAAAATGACTCTTTTAACTTTGATAAAAACTTCAACT
CTGAGCTTTCAATTAAACAGGAACCTCAAAATTTAACTGATGCTGAAATG
AATGCCCTAGCCAAGGACAGACAAAAGAAAGACAACCATAATATGATTGA
GCGAAGGCGACGCTTTAATATAAATGACAGAATAAAAGAGCTTGGTACCC
TTTTGCCAAAGGGCAGTGATGCTTTTTACGAAGTAGTTCGAGACATTCGT
CCAAACAAGGGGACAATCTTGAAGTCCTCTGTTGACTACATTAAATGCTT
GAAACATGAGGTGACTCGCTTAAGACAAAATGAGTTACGTCAACGTCAAG
TAGAGTTGCAAAATCGAAAGCTCATGTCTCGAATAAAAGAATTGGAAATG
CAGGCCAAGTCCCATGGAATTTTGTTATCAGAAAACCACCTAACATCACT
ATCAGCGCCTACTCAACCTTATCTTAAAAGTTTTAGCCTGTCTCCTACTG
CTTCTCGGAGTCGTCGATCACTTTTTGACCAACCTGTTGAAAAAAAAATA
CAAGTTATTGATGGTGCCGATGGAAATATGGGAATGAATCAGGTTGATGA
GTTTATGGAAGATTGCAAGTATGCAGTACAAGGCGGCGATCCGATGTTGT
CCTCGCATAGTCACATGCAATCCGCGCCACAATCACCGAGTTCAAAAACT
TTGAATAGTGGAAGTTTTGAACCAAAGAATTTTTCGGAGGCTGATGAAAG
CCTTTTTAGAGGCAAATCAAGTTTAGCATCAGATGACTGTTGCGGTATAA
ATTGCAGTACTTCGTGCTATATTCAACACCAATTGACTTCGCGTGAGGGC
CATCCAAATCATTCTCACCACACGGGTATACGAGAAATTCATAGTTTGTC
TGATTCGGCTCAAAACTCAGAGTTTAGTAGGCTTGAGCATTGCGATGATC
CACTTCTCTCATCTTCCCATAGGTCACTTGGCACCGTAGACGAAGATCAA
CATAATTCAGTTGATATGTCTGCAGTCATGGTACACGACTCCCTATCCTC
TTTGGTAGATGACAACAATAGCGAAACAATGGTTCTTGCATCTGACACAT
TGGATATTGAGTTATAAATGATAAAGTTGTTAAAATTCGATATAATTTCT
TTGAGGAATTATGTTAAATTCTACAAGGCTTAAAAGGTCCATCCTTTTTA
TAGTTTGTCAAACTCAGTGAACTTAAAATAACATGCTCTTTTATATGTAT
AGACCGTATTTTTTCAATTCATACTATTGATTCACTGAACATGTCGTTTA
CAAATGTATTATGATAAAAGCGCCTTAACGCTATTTATGTATAAACGGTA
TAACCAAACACTATATTAAATTTGTTACGTTAGTTTTAGTAAATGGAAAC
TGTTAGACTGTGACGAAACAAATATATGTGTCAACACTTACTTCCAAGAA
CTACATAGACACAAACAAAATATACCGATGAGAAAAAAAGAATATAAAGT
TTGTAAGTTATTGTGGATTTTTTCATAAGATTTGTGATTTGATAAAAAAA
ACACGAAATAAGAATGGTCTAATATTATATATACCTTTAATCTAAATCAT
CAGGTATAATTTCAGAGCGCCTTCCTTTTCAAATAAGGAGTTGTGATAAT
TGTGTATATTAACATTGACAAATGTTTTATGTATAAAATAAGTAAAAGAT
TCCTAAAGTATTGAATATATTAATTTTGTTCGGCTTAATATATACTATCA
CAATTTTAATAAAATGGCTAGTGCTTAAAAAAAAAAAAAAAAAAAA

MIP04163.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 16:24:54
Subject Length Description Subject Range Query Range Score Percent Strand
Mitf.b 3209 Mitf.b 1..3209 18..3226 16045 100 Plus
Mitf.f 3558 Mitf.f 1247..3037 1437..3227 8955 100 Plus
Mitf-RB 3096 Mitf-RB 1247..3037 1437..3227 8955 100 Plus
Mitf.f 3558 Mitf.f 346..1226 557..1437 4405 100 Plus
Mitf-RB 3096 Mitf-RB 346..1226 557..1437 4405 100 Plus
Blast to d_melanogaster_OreR.fa performed 2014-11-26 23:20:48
Subject Length Description Subject Range Query Range Score Percent Strand
chr4 1351717 chr4 1225796..1227028 1994..3226 6150 99.9 Plus
chr4 1351717 chr4 1222614..1223169 1..556 2780 100 Plus
chr4 1351717 chr4 1223834..1224262 1008..1436 2145 100 Plus
chr4 1351717 chr4 1223267..1223600 556..889 1670 100 Plus
chr4 1351717 chr4 1225286..1225528 1597..1839 1215 100 Plus
chr4 1351717 chr4 1225067..1225228 1435..1596 810 100 Plus
chr4 1351717 chr4 1225584..1225742 1839..1997 795 100 Plus
chr4 1351717 chr4 1223647..1223773 885..1011 620 99.2 Plus
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 23:20:44
Subject Length Description Subject Range Query Range Score Percent Strand
Mitf-RC 2514 CG43369-PC 1..2514 54..2567 12570 100 Plus
Mitf-RB 2193 CG43369-PB 162..2193 557..2567 9810 99 Plus
Mitf-RA 2193 CG43369-PA 162..2193 557..2567 9810 99 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 20:02:51 has no hits.
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 23:20:43
Subject Length Description Subject Range Query Range Score Percent Strand
Mitf-RC 3226 CG43369-RC 1..3226 1..3226 16130 100 Plus
Mitf-RB 3009 CG43369-RB 319..3009 557..3226 13105 99.2 Plus
Mitf-RA 4032 CG43369-RA 325..3015 557..3226 13105 99.2 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-26 23:20:47
Subject Length Description Subject Range Query Range Score Percent Strand
Mitf-PC 837 CG43369-PC 1..837 54..2564 3629 100 Plus
Mitf-PB 730 CG17469-PB 55..730 558..2564 2812 99 Plus
Mitf-PA 730 CG17469-PA 55..730 558..2564 2812 99 Plus
Mitf-PD 704 CG43369-PD 55..704 558..2564 2710 97.2 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 23:20:41
Subject Length Description Subject Range Query Range Score Percent Strand
4 1348131 4 1222218..1223451 1994..3227 6155 99.9 Plus
4 1348131 4 1219040..1219595 1..556 2780 100 Plus
4 1348131 4 1220260..1220688 1008..1436 2145 100 Plus
4 1348131 4 1219693..1220026 556..889 1670 100 Plus
4 1348131 4 1221708..1221950 1597..1839 1215 100 Plus
4 1348131 4 1221489..1221650 1435..1596 810 100 Plus
4 1348131 4 1222006..1222164 1839..1997 795 100 Plus
4 1348131 4 1220073..1220199 885..1011 620 99.2 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 18:19:17
Subject Length Description Subject Range Query Range Score Percent Strand
4 1331231 4 1205318..1206551 1994..3227 6155 99.9 Plus
4 1331231 4 1202140..1202695 1..556 2780 100 Plus
4 1331231 4 1203360..1203788 1008..1436 2145 100 Plus
4 1331231 4 1202793..1203126 556..889 1670 100 Plus
4 1331231 4 1204808..1205050 1597..1839 1215 100 Plus
4 1331231 4 1204589..1204750 1435..1596 810 100 Plus
4 1331231 4 1205106..1205264 1839..1997 795 100 Plus
4 1331231 4 1203173..1203299 885..1011 620 99.2 Plus
Blast to na_te.dros performed 2014-11-26 23:20:42
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6765..6847 569..650 151 66.3 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6720..6814 557..650 130 61.1 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2468..2531 593..657 124 67.7 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2420..2476 587..649 121 71.4 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2342..2425 567..649 120 61.9 Plus

MIP04163.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2014-11-27 01:28:54 Download gff for MIP04163.complete
Subject Subject Range Query Range Percent Splice Strand
chr4 1225800..1227028 1998..3226 100   Plus
chr4 1225584..1225742 1839..1997 100 -> Plus
chr4 1225286..1225527 1597..1838 100 -> Plus
chr4 1225069..1225228 1437..1596 100 -> Plus
chr4 1223834..1224262 1008..1436 100 -> Plus
chr4 1223650..1223769 888..1007 100 -> Plus
chr4 1223268..1223598 557..887 100 -> Plus
chr4 1222614..1223169 1..556 100 -> Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2009-10-19 17:51:23 Download gff for MIP04163.complete
Subject Subject Range Query Range Percent Splice Strand
Mitf-RB 162..1041 557..1436 100 <- Plus
Mitf-RB 1063..2193 1437..2567 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 13:49:59 Download gff for MIP04163.complete
Subject Subject Range Query Range Percent Splice Strand
Mitf-RB 1063..2193 1437..2567 100   Plus
Mitf-RB 162..1041 557..1436 100 <- Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 06:37:49 Download gff for MIP04163.complete
Subject Subject Range Query Range Percent Splice Strand
Mitf-RC 1..2514 54..2567 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 01:28:54 Download gff for MIP04163.complete
Subject Subject Range Query Range Percent Splice Strand
Mitf-RC 1..2514 54..2567 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2009-04-30 10:00:45 Download gff for MIP04163.complete
Subject Subject Range Query Range Percent Splice Strand
Mitf-RA 319..1198 557..1436 100 <- Plus
Mitf-RA 1220..3009 1437..3226 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 13:49:59 Download gff for MIP04163.complete
Subject Subject Range Query Range Percent Splice Strand
Mitf-RA 1220..3009 1437..3226 100   Plus
Mitf-RA 319..1198 557..1436 100 <- Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 06:37:49 Download gff for MIP04163.complete
Subject Subject Range Query Range Percent Splice Strand
Mitf-RC 1..3226 1..3226 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 01:28:54 Download gff for MIP04163.complete
Subject Subject Range Query Range Percent Splice Strand
Mitf-RC 1..3226 1..3226 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 01:28:54 Download gff for MIP04163.complete
Subject Subject Range Query Range Percent Splice Strand
4 1222222..1223450 1998..3226 100   Plus
4 1222006..1222164 1839..1997 100 -> Plus
4 1221708..1221949 1597..1838 100 -> Plus
4 1221491..1221650 1437..1596 100 -> Plus
4 1220260..1220688 1008..1436 100 -> Plus
4 1220076..1220195 888..1007 100 -> Plus
4 1219694..1220024 557..887 100 -> Plus
4 1219040..1219595 1..556 100 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 06:37:49 Download gff for MIP04163.complete
Subject Subject Range Query Range Percent Splice Strand
arm_4 1225948..1227176 1998..3226 100   Plus
arm_4 1225732..1225890 1839..1997 100 -> Plus
arm_4 1225434..1225675 1597..1838 100 -> Plus
arm_4 1225217..1225376 1437..1596 100 -> Plus
arm_4 1223986..1224414 1008..1436 100 -> Plus
arm_4 1223802..1223921 888..1007 100 -> Plus
arm_4 1223420..1223750 557..887 100 -> Plus
arm_4 1222766..1223321 1..556 100 -> Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 11:40:53 Download gff for MIP04163.complete
Subject Subject Range Query Range Percent Splice Strand
4 1205322..1206550 1998..3226 100   Plus
4 1205106..1205264 1839..1997 100 -> Plus
4 1204808..1205049 1597..1838 100 -> Plus
4 1204591..1204750 1437..1596 100 -> Plus
4 1203360..1203788 1008..1436 100 -> Plus
4 1203176..1203295 888..1007 100 -> Plus
4 1202794..1203124 557..887 100 -> Plus
4 1202140..1202695 1..556 100 -> Plus

MIP04163.hyp Sequence

Translation from 53 to 2566

> MIP04163.hyp
MFSYWTKQNISSSVDGKKMDKVSTMRKKNSTKVKMEKKETVVPITEMRAL
EFQDFLKRVQTLQMSHNESRDLVNGPNICSSMDIEVGEEPPTTSFADNID
KACPLPVLRSSDCDCVPLCMTNIRVSVGIDKDLEMILEMDPSIVDLGDIS
IDETAEPRIVGLPPLSGGPTFKTATPTSRTQLKLQLQREQQQQMMIQQQT
LDTAMDPKMHLLFGSGQGLMESEFIDSGSTSACGSGSSSLEQMSQLVQMD
NLIDSSSGAKLKVPLQSIGVDVPPQVLQVSTVLENPTRYHVIQKQKNQVR
QYLSESFKPSMWGSHTSEIKLANNSASTGNLQNSSLQKGICDPLERTNRF
GCDSAVSAKRIMPSDDAMPISPFGGSFVRCDDINPIEPTVLRPNSHGAGE
PENAHRTAQLGLSKANSSLSSTRSSSGIVNSIRISSTSSSLQSTSAPISP
SVSSVATSVSEPDDIFDDILQNDSFNFDKNFNSELSIKQEPQNLTDAEMN
ALAKDRQKKDNHNMIERRRRFNINDRIKELGTLLPKGSDAFYEVVRDIRP
NKGTILKSSVDYIKCLKHEVTRLRQNELRQRQVELQNRKLMSRIKELEMQ
AKSHGILLSENHLTSLSAPTQPYLKSFSLSPTASRSRRSLFDQPVEKKIQ
VIDGADGNMGMNQVDEFMEDCKYAVQGGDPMLSSHSHMQSAPQSPSSKTL
NSGSFEPKNFSEADESLFRGKSSLASDDCCGINCSTSCYIQHQLTSREGH
PNHSHHTGIREIHSLSDSAQNSEFSRLEHCDDPLLSSSHRSLGTVDEDQH
NSVDMSAVMVHDSLSSLVDDNNSETMVLASDTLDIEL*

MIP04163.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 14:53:36
Subject Length Description Subject Range Query Range Score Percent Strand
Mitf-PC 837 CG43369-PC 1..837 1..837 4281 100 Plus
Mitf-PB 730 CG17469-PB 55..730 169..837 3395 99 Plus
Mitf-PA 730 CG17469-PA 55..730 169..837 3395 99 Plus
Mitf-PD 704 CG43369-PD 55..704 169..837 3293 97.2 Plus

MIP04163.pep Sequence

Translation from 53 to 2566

> MIP04163.pep
MFSYWTKQNISSSVDGKKMDKVSTMRKKNSTKVKMEKKETVVPITEMRAL
EFQDFLKRVQTLQMSHNESRDLVNGPNICSSMDIEVGEEPPTTSFADNID
KACPLPVLRSSDCDCVPLCMTNIRVSVGIDKDLEMILEMDPSIVDLGDIS
IDETAEPRIVGLPPLSGGPTFKTATPTSRTQLKLQLQREQQQQMMIQQQT
LDTAMDPKMHLLFGSGQGLMESEFIDSGSTSACGSGSSSLEQMSQLVQMD
NLIDSSSGAKLKVPLQSIGVDVPPQVLQVSTVLENPTRYHVIQKQKNQVR
QYLSESFKPSMWGSHTSEIKLANNSASTGNLQNSSLQKGICDPLERTNRF
GCDSAVSAKRIMPSDDAMPISPFGGSFVRCDDINPIEPTVLRPNSHGAGE
PENAHRTAQLGLSKANSSLSSTRSSSGIVNSIRISSTSSSLQSTSAPISP
SVSSVATSVSEPDDIFDDILQNDSFNFDKNFNSELSIKQEPQNLTDAEMN
ALAKDRQKKDNHNMIERRRRFNINDRIKELGTLLPKGSDAFYEVVRDIRP
NKGTILKSSVDYIKCLKHEVTRLRQNELRQRQVELQNRKLMSRIKELEMQ
AKSHGILLSENHLTSLSAPTQPYLKSFSLSPTASRSRRSLFDQPVEKKIQ
VIDGADGNMGMNQVDEFMEDCKYAVQGGDPMLSSHSHMQSAPQSPSSKTL
NSGSFEPKNFSEADESLFRGKSSLASDDCCGINCSTSCYIQHQLTSREGH
PNHSHHTGIREIHSLSDSAQNSEFSRLEHCDDPLLSSSHRSLGTVDEDQH
NSVDMSAVMVHDSLSSLVDDNNSETMVLASDTLDIEL*

MIP04163.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2014-11-28 09:24:23
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF23419-PA 723 GF23419-PA 60..723 169..837 1793 58.8 Plus
Blast to dere-all-translation-r1.3.fasta performed 2014-11-28 09:24:25
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG16411-PA 735 GG16411-PA 60..735 169..837 2873 87.6 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2014-11-28 09:24:27
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH23990-PA 814 GH23990-PA 73..814 47..837 1442 50.1 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 09:24:21
Subject Length Description Subject Range Query Range Score Percent Strand
Mitf-PC 837 CG43369-PC 1..837 1..837 4281 100 Plus
Mitf-PB 730 CG17469-PB 55..730 169..837 3395 99 Plus
Mitf-PA 730 CG17469-PA 55..730 169..837 3395 99 Plus
Mitf-PD 704 CG43369-PD 55..704 169..837 3293 97.2 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2014-11-28 09:24:28
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI14117-PA 750 GI14117-PA 54..750 169..837 1412 53 Plus
Blast to dper-all-translation-r1.3.fasta performed 2014-11-28 09:24:30
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL18375-PA 670 GL18375-PA 284..670 460..837 1287 67.1 Plus
Dper\GL18375-PA 670 GL18375-PA 61..276 169..384 676 71.1 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2014-11-28 09:24:32
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA27856-PA 834 GA27856-PA 61..834 81..837 2283 65.4 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2014-11-28 09:24:34
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM13030-PA 730 GM13030-PA 55..730 169..837 3010 94.8 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2014-11-28 09:24:35
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD24380-PA 388 GD24380-PA 10..388 459..837 1932 95 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2014-11-28 09:24:37
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ14595-PA 894 GJ14595-PA 91..894 41..837 1743 54.5 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2014-11-28 09:24:39
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK13654-PA 735 GK13654-PA 60..735 169..837 1473 56.2 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2014-11-28 09:24:41
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE14571-PA 738 GE14571-PA 60..738 169..837 2786 86 Plus