Clone MIP04243 Report

Search the DGRC for MIP04243

Clone and Library Details

Library:MIP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by:
Date Registered:2008-10-08
Comments:
Original Plate Number:42
Well:43
Vector:pOT2
Associated Gene/TranscriptCG5028-RC
Protein status:MIP04243.pep: gold
Sequenced Size:1606

Clone Sequence Records

MIP04243.complete Sequence

1606 bp assembled on 2009-05-01

GenBank Submission: BT082126.1

> MIP04243.complete
CAGCAGCACCGTTTTGGCCAAGTGGAATAAAATTGGCTGTGATTTAACTG
ATAGTAGAATACCAACTGCAGCGGTAGAAAACAATAATCCAAGGATCAAA
TCATGGCCCTTCGCTTGACCCAGAGATTGCTGCAGACGCAGACGCCGTTC
CTCACTCGCGGCTATCCCTTGCTGGTGACCAAGGAGAAGACCGAGGATGT
GGCCCACACCAAATCGGCGCTGCAGAAGAAAGTCACGGGCACCGATATTC
CCTCGGCACAGTACGGAGGTCGTCATGCCGTCACCATGCTGCCGGGCGGC
GGCATTGGTCCTGAACTGATGGGCTATGTGCGCGAGATCTTCCGGTATTG
CGGTGCACCCATCGATTTCGAGGTGATCGACATCGATCCCTCCACCGAGG
GCAACGATGATCTGGACTATGCCATCACATCGATTAAGAGGAACGGAGTG
GCACTCAAGGGCAACATCGAGACCAAGTCCCAATCCTTGACCGAAGTCTC
CCGCAACGTGGCCATCCGTAACGAGCTGGATCTGTACGTCAATGTGGTGC
ACTGCAAGTCGTATCCGGGCATTCCGGCCCGCCATCACGACATTGACGTG
GTGCTCATCCGCCAAAACACCGATGGCGAGTACGCCATGTTGGAACATGA
GTCTGTGCCCGGAATTGTGGAGAGCATGAAAGTGGTGACCGTCGAGAATG
CCGAGCGTGTGGCCCGCTACGCCTTTGAGTTCGCCCGCCAAAACAATCGC
AAGAAGGTTACCACCATTCACAAGGCCAACATCATGAAGCTGTCCGATGG
TCTCTTCCTGGAGGTTGCCAACCGTGTGCACAAGGACTATCCCGAACTGG
AGCACAACAACATGATTATCGACAACACCTGCATGCAGTCCGTGTCGAAT
CCTCACCAGTTCGACGTGATGAACATGACCAATCTGTACGGCACCATCGT
GTCCAATGTTCTTTGCGGTTTGATGGGCGGAGCTGGCCTCATATCCGGCA
GGAACTACGGTGACCATTACGCCATCTTTGAGCCTGGCACCCGTAACACC
GGAACCGCCATTGCCGGCAAGAATATCGCCAACCCTGTGGCCATGATCAG
TGCCAGTATCGATATGTTGAACCATCTGGGCCACAAGGAGCACGCCAATG
TCATTCAGGAGGCCGTCTACCAGACCATTGTCAACGATGCCATTCGCACG
CCAGATATTGGCGGCACCAACTCCAGTACCGATGTGGTTGAGAATATACT
CAAGATCTTGAGTGCCAAGCGCGTGAATTGATTTTCTTGCCGGCCCTATC
CAATGTTTTTGCACTCTGAATCTTTCTTTTAAACTCCCTACTGAAAGCTG
TATATTTTCTTTTATTTTACTTAATTTCCAAAATACCCTAAGGCAACAGT
TCATGAACAACAAGAATAACACACTTTGAGCTCTTCAAAAGCCAAGCAAG
TTCCACAAGTAGTCAATCAAAGCGATATTAAATTGTAAATTTTCCAAAAG
ATTTGTAATATTGAAAAGTTGATTCAAACAAAATGTATTATTCTGTTCGA
ATATTTATTAGTAAAGGAAAAAGTAAAAAAGACACTGTAAAAAAAAAAAA
AAAAAA

MIP04243.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 16:25:08
Subject Length Description Subject Range Query Range Score Percent Strand
CG5028-RC 1626 CG5028-RC 127..1626 1..1500 7500 100 Plus
CG5028-RB 2038 CG5028-RB 127..1406 1..1280 6400 100 Plus
CG5028.c 2032 CG5028.c 280..1400 160..1280 5605 100 Plus
CG5028.c 2032 CG5028.c 1726..2032 1280..1586 1535 100 Plus
CG5028-RB 2038 CG5028-RB 1732..2038 1280..1586 1535 100 Plus
CG5028.c 2032 CG5028.c 24..183 1..160 800 100 Plus
Blast to d_melanogaster_OreR.fa performed 2014-11-27 13:39:23
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 21504299..21505079 237..1017 3905 100 Plus
chr3R 27901430 chr3R 21506506..21506814 1280..1588 1545 100 Plus
chr3R 27901430 chr3R 21505139..21505325 1018..1204 935 100 Plus
chr3R 27901430 chr3R 21503899..21504058 1..160 800 100 Plus
chr3R 27901430 chr3R 21504155..21504233 160..238 395 100 Plus
chr3R 27901430 chr3R 21505387..21505465 1202..1280 395 100 Plus
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 13:39:19
Subject Length Description Subject Range Query Range Score Percent Strand
CG5028-RC 1179 CG5028-PC 1..1179 103..1281 5895 100 Plus
CG5028-RD 1182 CG5028-PD 1..1178 103..1280 5890 100 Plus
CG5028-RB 1209 CG5028-PB 1..1178 103..1280 5890 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 20:03:00 has no hits.
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 13:39:18
Subject Length Description Subject Range Query Range Score Percent Strand
CG5028-RC 1608 CG5028-RC 21..1608 1..1588 7940 100 Plus
CG5028-RD 1742 CG5028-RD 21..1300 1..1280 6400 100 Plus
CG5028-RB 1934 CG5028-RB 21..1300 1..1280 6400 100 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 13:39:22
Subject Length Description Subject Range Query Range Score Percent Strand
CG5028-PC 392 CG5028-PC 20..392 160..1278 1930 100 Plus
CG5028-PD 393 CG5028-PD 20..392 160..1278 1930 100 Plus
CG5028-PB 402 CG5028-PB 20..392 160..1278 1930 100 Plus
CG5028-PA 402 CG5028-PA 20..392 160..1278 1930 100 Plus
CG6439-PB 370 CG6439-PB 22..370 205..1263 791 43.7 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 13:39:16
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 25681265..25682045 237..1017 3905 100 Plus
3R 32079331 3R 25683472..25683782 1280..1590 1555 100 Plus
3R 32079331 3R 25682105..25682291 1018..1204 935 100 Plus
3R 32079331 3R 25680865..25681024 1..160 800 100 Plus
3R 32079331 3R 25681121..25681199 160..238 395 100 Plus
3R 32079331 3R 25682353..25682431 1202..1280 395 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 18:19:29
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 25422096..25422876 237..1017 3905 100 Plus
3R 31820162 3R 25424303..25424613 1280..1590 1555 100 Plus
3R 31820162 3R 25422936..25423122 1018..1204 935 100 Plus
3R 31820162 3R 25421696..25421855 1..160 800 100 Plus
3R 31820162 3R 25423184..25423262 1202..1280 395 100 Plus
3R 31820162 3R 25421952..25422030 160..238 395 100 Plus
Blast to na_te.dros performed 2014-11-27 13:39:17
Subject Length Description Subject Range Query Range Score Percent Strand
Dhyd\Minos 1773 Dhyd\Minos DHMINOS 1773bp Derived from Z29098. 462..556 1418..1517 120 60 Plus

MIP04243.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2014-11-27 15:38:43 Download gff for MIP04243.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 21506507..21506814 1281..1588 100   Plus
chr3R 21505390..21505465 1205..1280 100 -> Plus
chr3R 21505139..21505325 1018..1204 100 -> Plus
chr3R 21504300..21505079 238..1017 100 -> Plus
chr3R 21504155..21504232 160..237 100 -> Plus
chr3R 21503899..21504057 1..159 100 -> Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2009-10-19 17:51:46 Download gff for MIP04243.complete
Subject Subject Range Query Range Percent Splice Strand
CG5028-RC 1..1178 103..1280 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 13:50:15 Download gff for MIP04243.complete
Subject Subject Range Query Range Percent Splice Strand
CG5028-RC 1..1179 103..1281 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 17:44:58 Download gff for MIP04243.complete
Subject Subject Range Query Range Percent Splice Strand
CG5028-RC 1..1179 103..1281 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 15:38:43 Download gff for MIP04243.complete
Subject Subject Range Query Range Percent Splice Strand
CG5028-RC 1..1179 103..1281 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2009-05-01 09:35:25 Download gff for MIP04243.complete
Subject Subject Range Query Range Percent Splice Strand
CG5028-RC 48..1496 1..1449 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 13:50:15 Download gff for MIP04243.complete
Subject Subject Range Query Range Percent Splice Strand
CG5028-RC 48..1496 1..1449 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:44:58 Download gff for MIP04243.complete
Subject Subject Range Query Range Percent Splice Strand
CG5028-RC 21..1608 1..1588 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 15:38:43 Download gff for MIP04243.complete
Subject Subject Range Query Range Percent Splice Strand
CG5028-RC 21..1608 1..1588 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 15:38:43 Download gff for MIP04243.complete
Subject Subject Range Query Range Percent Splice Strand
3R 25683473..25683780 1281..1588 100   Plus
3R 25682356..25682431 1205..1280 100 -> Plus
3R 25682105..25682291 1018..1204 100 -> Plus
3R 25681266..25682045 238..1017 100 -> Plus
3R 25681121..25681198 160..237 100 -> Plus
3R 25680865..25681023 1..159 100 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:44:58 Download gff for MIP04243.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 21509195..21509502 1281..1588 100   Plus
arm_3R 21508078..21508153 1205..1280 100 -> Plus
arm_3R 21507827..21508013 1018..1204 100 -> Plus
arm_3R 21506988..21507767 238..1017 100 -> Plus
arm_3R 21506843..21506920 160..237 100 -> Plus
arm_3R 21506587..21506745 1..159 100 -> Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 11:41:10 Download gff for MIP04243.complete
Subject Subject Range Query Range Percent Splice Strand
3R 25424304..25424611 1281..1588 100   Plus
3R 25423187..25423262 1205..1280 100 -> Plus
3R 25422936..25423122 1018..1204 100 -> Plus
3R 25422097..25422876 238..1017 100 -> Plus
3R 25421952..25422029 160..237 100 -> Plus
3R 25421696..25421854 1..159 100 -> Plus

MIP04243.pep Sequence

Translation from 102 to 1280

> MIP04243.pep
MALRLTQRLLQTQTPFLTRGYPLLVTKEKTEDVAHTKSALQKKVTGTDIP
SAQYGGRHAVTMLPGGGIGPELMGYVREIFRYCGAPIDFEVIDIDPSTEG
NDDLDYAITSIKRNGVALKGNIETKSQSLTEVSRNVAIRNELDLYVNVVH
CKSYPGIPARHHDIDVVLIRQNTDGEYAMLEHESVPGIVESMKVVTVENA
ERVARYAFEFARQNNRKKVTTIHKANIMKLSDGLFLEVANRVHKDYPELE
HNNMIIDNTCMQSVSNPHQFDVMNMTNLYGTIVSNVLCGLMGGAGLISGR
NYGDHYAIFEPGTRNTGTAIAGKNIANPVAMISASIDMLNHLGHKEHANV
IQEAVYQTIVNDAIRTPDIGGTNSSTDVVENILKILSAKRVN*

MIP04243.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2014-11-28 07:24:19
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF16768-PA 402 GF16768-PA 1..392 1..392 2000 94.9 Plus
Dana\GF22695-PA 255 GF22695-PA 1..245 148..392 1232 93.1 Plus
Dana\GF16953-PA 371 GF16953-PA 38..367 57..383 775 45.8 Plus
Dana\GF20487-PA 377 GF20487-PA 42..377 52..386 675 40.7 Plus
Dana\GF13612-PA 412 GF13612-PA 88..403 60..382 445 31.7 Plus
Blast to dere-all-translation-r1.3.fasta performed 2014-11-28 07:24:20
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG11421-PA 402 GG11421-PA 1..392 1..392 2079 99.2 Plus
Dere\GG12546-PA 370 GG12546-PA 22..366 35..383 764 43.9 Plus
Dere\GG18052-PA 377 GG18052-PA 32..373 43..382 672 40.6 Plus
Dere\GG22965-PA 395 GG22965-PA 3..393 6..388 465 27.6 Plus
Dere\GG22281-PA 378 GG22281-PA 29..377 37..392 413 29.8 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2014-11-28 07:24:22
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH18988-PA 402 GH18988-PA 1..392 1..392 1936 91.1 Plus
Dgri\GH19869-PA 370 GH19869-PA 35..366 55..383 771 45.5 Plus
Dgri\GH17867-PA 354 GH17867-PA 6..354 40..386 672 40.1 Plus
Dgri\GH16376-PA 361 GH16376-PA 21..349 60..387 664 41.7 Plus
Dgri\GH20895-PA 386 GH20895-PA 63..382 60..387 521 34.7 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 07:24:18
Subject Length Description Subject Range Query Range Score Percent Strand
CG5028-PC 392 CG5028-PC 1..392 1..392 2022 100 Plus
CG5028-PD 393 CG5028-PD 1..392 1..392 2022 100 Plus
CG5028-PB 402 CG5028-PB 1..392 1..392 2022 100 Plus
CG5028-PA 402 CG5028-PA 1..392 1..392 2022 100 Plus
CG6439-PB 370 CG6439-PB 22..370 35..387 791 43.7 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2014-11-28 07:24:23
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI22415-PA 402 GI22415-PA 1..392 1..392 1980 93.4 Plus
Dmoj\GI22037-PA 370 GI22037-PA 27..366 44..383 782 46.1 Plus
Dmoj\GI16435-PA 377 GI16435-PA 1..377 1..386 697 39.7 Plus
Dmoj\GI11568-PA 354 GI11568-PA 27..350 60..382 687 42.3 Plus
Dmoj\GI18905-PA 399 GI18905-PA 78..395 60..387 489 32.4 Plus
Blast to dper-all-translation-r1.3.fasta performed 2014-11-28 07:24:24
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL21529-PA 402 GL21529-PA 1..392 1..392 1979 93.6 Plus
Dper\GL23725-PA 378 GL23725-PA 22..374 35..383 794 45.1 Plus
Dper\GL14780-PA 351 GL14780-PA 38..351 52..386 567 37.5 Plus
Dper\GL11354-PA 395 GL11354-PA 33..383 22..386 454 30.5 Plus
Dper\GL20101-PA 411 GL20101-PA 86..411 57..389 447 30.1 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2014-11-28 07:24:25
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA18606-PA 402 GA18606-PA 1..392 1..392 1979 93.6 Plus
Dpse\GA19594-PA 378 GA19594-PA 22..374 35..383 794 45.1 Plus
Dpse\GA11495-PA 373 GA11495-PA 38..373 52..386 671 40.4 Plus
Dpse\GA16620-PA 332 GA16620-PA 1..329 63..384 581 36.3 Plus
Dpse\GA24694-PA 395 GA24694-PA 33..383 22..386 454 30.5 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2014-11-28 07:24:26
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM10262-PA 321 GM10262-PA 1..320 73..392 1700 99.7 Plus
Dsec\GM23677-PA 370 GM23677-PA 33..366 54..383 762 44.6 Plus
Dsec\GM22739-PA 377 GM22739-PA 1..377 1..386 685 38.4 Plus
Dsec\GM11859-PA 389 GM11859-PA 3..389 6..386 459 28.8 Plus
Dsec\GM20069-PA 378 GM20069-PA 45..374 49..389 412 31.2 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2014-11-28 07:24:28
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD21232-PA 392 GD21232-PA 1..391 1..392 1979 95.9 Plus
Dsim\GD18486-PA 370 GD18486-PA 33..366 54..383 762 44.6 Plus
Dsim\GD15579-PA 377 GD15579-PA 1..377 1..386 686 37.9 Plus
Dsim\GD14133-PA 722 GD14133-PA 388..721 60..386 580 36.6 Plus
Dsim\GD11857-PA 388 GD11857-PA 3..388 6..386 425 28 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2014-11-28 07:24:30
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ10975-PA 402 GJ10975-PA 1..392 1..392 1946 91.1 Plus
Dvir\GJ24090-PA 371 GJ24090-PA 28..367 48..383 778 45.6 Plus
Dvir\GJ11248-PA 367 GJ11248-PA 23..358 56..389 690 40.8 Plus
Dvir\GJ20729-PA 426 GJ20729-PA 73..422 28..387 496 31.9 Plus
Dvir\GJ22018-PA 392 GJ22018-PA 54..382 49..388 484 31.6 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2014-11-28 07:24:31
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK12856-PA 402 GK12856-PA 1..392 1..392 1976 93.9 Plus
Dwil\GK13007-PA 370 GK13007-PA 31..366 52..383 764 44.7 Plus
Dwil\GK25509-PA 379 GK25509-PA 31..379 40..386 675 39.8 Plus
Dwil\GK19318-PA 388 GK19318-PA 52..378 49..386 466 32.6 Plus
Dwil\GK19462-PA 390 GK19462-PA 7..294 78..370 450 34.1 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2014-11-28 07:24:34
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE23616-PA 402 GE23616-PA 1..392 1..392 2086 99.7 Plus
Dyak\GE24066-PA 370 GE24066-PA 33..366 54..383 762 44.6 Plus
Dyak\GE14404-PA 393 GE14404-PA 20..391 21..388 467 29.5 Plus
Dyak\GE14076-PA 378 GE14076-PA 45..377 49..392 422 30.3 Plus
Dyak\GE17383-PA 268 GE17383-PA 112..268 229..386 279 35.4 Plus

MIP04243.hyp Sequence

Translation from 102 to 1280

> MIP04243.hyp
MALRLTQRLLQTQTPFLTRGYPLLVTKEKTEDVAHTKSALQKKVTGTDIP
SAQYGGRHAVTMLPGGGIGPELMGYVREIFRYCGAPIDFEVIDIDPSTEG
NDDLDYAITSIKRNGVALKGNIETKSQSLTEVSRNVAIRNELDLYVNVVH
CKSYPGIPARHHDIDVVLIRQNTDGEYAMLEHESVPGIVESMKVVTVENA
ERVARYAFEFARQNNRKKVTTIHKANIMKLSDGLFLEVANRVHKDYPELE
HNNMIIDNTCMQSVSNPHQFDVMNMTNLYGTIVSNVLCGLMGGAGLISGR
NYGDHYAIFEPGTRNTGTAIAGKNIANPVAMISASIDMLNHLGHKEHANV
IQEAVYQTIVNDAIRTPDIGGTNSSTDVVENILKILSAKRVN*

MIP04243.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 14:35:02
Subject Length Description Subject Range Query Range Score Percent Strand
CG5028-PC 392 CG5028-PC 1..392 1..392 2022 100 Plus
CG5028-PD 393 CG5028-PD 1..392 1..392 2022 100 Plus
CG5028-PB 402 CG5028-PB 1..392 1..392 2022 100 Plus
CG5028-PA 402 CG5028-PA 1..392 1..392 2022 100 Plus
CG6439-PB 370 CG6439-PB 22..370 35..387 791 43.7 Plus