Clone MIP04261 Report

Search the DGRC for MIP04261

Clone and Library Details

Library:MIP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by:
Date Registered:2008-10-08
Comments:
Original Plate Number:42
Well:61
Vector:pOT2
Associated Gene/TranscriptCG1287-RA
Protein status:MIP04261.pep: gold
Sequenced Size:1427

Clone Sequence Records

MIP04261.complete Sequence

1427 bp assembled on 2009-04-08

GenBank Submission: BT082005.1

> MIP04261.complete
AATTTGTTTAGCTAAATTGTTCATTAAAACTGCCAAAACTCATAACCCCC
TTCTTATTATTACCTTTCTGACGTTGTACAAGATACTCAATACAGTACAC
CACATATAATTTCGAAATGCTTTTGGCCCGTTTAAACCATGTGCTGTCAG
GACGACCGATGCGCCTTTTGGGCCAGTCTGGATGTCCTCGCCTGTGGAGC
TCAGCCCATGCGCAGATGAACAGTAATTCCTTAAGAACACCTTCCTTGGC
TCAAGGAAAGTCAGTGATTCCTAAAAGGAATATGCAAGAACTTGGGATGA
GAAAGTATTCCAGGGAGTCGAGAGATCGCGATCGTTCCCAACTGGAGAGT
CGAACCAGAGGTCCTTCCCTCAAGGAGCGCATGATGGGACCCCCCAGTGA
AAATGCTTACTCCATGGGCAAGGGAGCGGCGGCTGGAGCGGCTCTGATGG
GTCTCGTGGGTCTGTGCTACTATGGTCTGGGCCTTGCCAATCAACCGAGT
ATCTACGACCACTCGATGGTGTGGCCCCAGTACGTGAGGGATCGTATTCA
TGCCACCTATGCCTATTTCGGAGCATCCTGTGGTGTAACAGCTGCTTCAG
CCGTTGCCTTTTTCCAATCGGATGCCATGATGGCTCTGATGACGCGTTCT
GGATGGGTTGCCTCATTGGTTACCCTGGGACTGGTAATGCTCAGTGGATC
CATTGCACAAGGCCTAGAATATCAGCCGGGATTCGGAGCCAAGCAGCTGG
CCTGGCTCGTCCACTGTGCCGTTCTGGGAGCTGTCCTGGCACCCATGTGC
CTCCTGGGTGGACCCATTTTGACCAAGGCCCTTTTGTACACCAGCGGAAT
CGTGGGTGCCCTGTCCACCGTGGCCGCTTGTGCCCCGAGCGAAAAGTTCC
TGCATATGGGCGGACCGCTGGCCATTGGATTGGGCGTGGTCTTCGCCTCC
TCGCTAGCCTCCATGTGGTTGCCGCCCACTACTGCAGTGGGGGCGGGACT
GGCCAGCATGTCGTTGTACGGCGGACTGATTCTGTTCAGCGGATTTCTTC
TGTACGATACCCAAAGGATCGTTAAGTCGGCGGAGTTGTATCCCCAGTAC
AGTAAATTCCCTTACGATCCAATTAATCATGCCCTGGCCATTTACATGGA
TGCGCTCAACATCTTTATCCGCATCGCAATTATATTGGCTGGAGACCAAA
AGAGGAAGAACTGAGTTGGTTTAAGGTGTAGGAAAACCTAAATTTATTCA
GATACACAAAATAAACCGCCTGGGGTTTTACCACAAATTGTATAATTTAG
TTAGAATTACCCATTTTCATATTTTGAAATGTATCTTTTCGAAATTGTTC
GAAGCTAAAGCACAAATCTAAAAAATAACATTAAATTTGAAATGGTTTTT
CAAATTTCTAAAAAAAAAAAAAAAAAA

MIP04261.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 21:29:46
Subject Length Description Subject Range Query Range Score Percent Strand
CG1287-RA 1426 CG1287-RA 18..1426 1..1409 7045 100 Plus
CG2076-RA 1495 CG2076-RA 963..1138 837..1012 385 81.2 Plus
CG2076-RA 1495 CG2076-RA 849..949 723..823 205 80.1 Plus
CG2076-RA 1495 CG2076-RA 508..565 382..439 140 82.7 Plus
Blast to d_melanogaster_OreR.fa performed 2014-11-27 10:21:08
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 3327014..3328422 1409..1 6985 99.7 Minus
chrX 22417052 chrX 10982605..10982861 723..979 505 79.8 Plus
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 10:21:05
Subject Length Description Subject Range Query Range Score Percent Strand
CG1287-RA 1098 CG1287-PA 1..1098 117..1214 5490 100 Plus
CG2076-RB 1026 CG2076-PB 538..991 723..1176 545 74.7 Plus
CG2076-RA 1026 CG2076-PA 538..991 723..1176 545 74.7 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 20:03:02 has no hits.
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 10:21:04
Subject Length Description Subject Range Query Range Score Percent Strand
CG1287-RA 1426 CG1287-RA 18..1426 1..1409 7045 100 Plus
CG2076-RB 1491 CG2076-RB 907..1360 723..1176 545 74.7 Plus
CG2076-RA 1319 CG2076-RA 735..1188 723..1176 545 74.7 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 10:21:07
Subject Length Description Subject Range Query Range Score Percent Strand
CG1287-PA 365 CG1287-PA 1..365 117..1211 1731 100 Plus
CG2076-PB 341 CG2076-PB 34..341 279..1208 972 67.1 Plus
CG2076-PA 341 CG2076-PA 34..341 279..1208 972 67.1 Plus
BI-1-PA 245 CG7188-PA 26..235 531..1208 166 27.3 Plus
BI-1-PB 237 CG7188-PB 26..228 531..1187 156 27.3 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 10:21:02
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 7500946..7502359 1414..1 7070 100 Minus
X 23542271 X 11091354..11091610 723..979 505 79.8 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:46:26
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 7241777..7243190 1414..1 7070 100 Minus
X 23527363 X 11099566..11099708 837..979 355 83.2 Plus
X 23527363 X 11099452..11099552 723..823 205 80.1 Plus
Blast to na_te.dros performed 2014-11-27 10:21:03
Subject Length Description Subject Range Query Range Score Percent Strand
copia 5143 copia DMCOPIA 5143bp Derived from X02599 (g7740) (Rel. 49, Last updated, Version 4). 773..855 1305..1388 129 63.1 Plus

MIP04261.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2014-11-27 11:41:24 Download gff for MIP04261.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 3327014..3328422 1..1409 99   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2009-10-19 18:09:04 Download gff for MIP04261.complete
Subject Subject Range Query Range Percent Splice Strand
CG1287-RA 1..1098 117..1214 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 21:44:39 Download gff for MIP04261.complete
Subject Subject Range Query Range Percent Splice Strand
CG1287-RA 1..1098 117..1214 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 16:41:11 Download gff for MIP04261.complete
Subject Subject Range Query Range Percent Splice Strand
CG1287-RA 1..1098 117..1214 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 11:41:24 Download gff for MIP04261.complete
Subject Subject Range Query Range Percent Splice Strand
CG1287-RA 1..1098 117..1214 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2009-04-08 12:26:23 Download gff for MIP04261.complete
Subject Subject Range Query Range Percent Splice Strand
CG1287-RA 18..1426 1..1409 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 21:44:39 Download gff for MIP04261.complete
Subject Subject Range Query Range Percent Splice Strand
CG1287-RA 18..1426 1..1409 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 16:41:11 Download gff for MIP04261.complete
Subject Subject Range Query Range Percent Splice Strand
CG1287-RA 18..1426 1..1409 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 11:41:24 Download gff for MIP04261.complete
Subject Subject Range Query Range Percent Splice Strand
CG1287-RA 18..1426 1..1409 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 11:41:24 Download gff for MIP04261.complete
Subject Subject Range Query Range Percent Splice Strand
3R 7500951..7502359 1..1409 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 16:41:11 Download gff for MIP04261.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 3326673..3328081 1..1409 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 19:19:48 Download gff for MIP04261.complete
Subject Subject Range Query Range Percent Splice Strand
3R 7241782..7243190 1..1409 100   Minus

MIP04261.pep Sequence

Translation from 116 to 1213

> MIP04261.pep
MLLARLNHVLSGRPMRLLGQSGCPRLWSSAHAQMNSNSLRTPSLAQGKSV
IPKRNMQELGMRKYSRESRDRDRSQLESRTRGPSLKERMMGPPSENAYSM
GKGAAAGAALMGLVGLCYYGLGLANQPSIYDHSMVWPQYVRDRIHATYAY
FGASCGVTAASAVAFFQSDAMMALMTRSGWVASLVTLGLVMLSGSIAQGL
EYQPGFGAKQLAWLVHCAVLGAVLAPMCLLGGPILTKALLYTSGIVGALS
TVAACAPSEKFLHMGGPLAIGLGVVFASSLASMWLPPTTAVGAGLASMSL
YGGLILFSGFLLYDTQRIVKSAELYPQYSKFPYDPINHALAIYMDALNIF
IRIAIILAGDQKRKN*

MIP04261.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2014-11-28 08:36:31
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF17301-PA 383 GF17301-PA 19..383 1..365 1475 78.9 Plus
Dana\GF20290-PA 340 GF20290-PA 30..340 53..364 1011 65.8 Plus
Dana\GF23562-PA 243 GF23562-PA 23..235 136..364 159 27.4 Plus
Blast to dere-all-translation-r1.3.fasta performed 2014-11-28 08:36:32
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG25161-PA 365 GG25161-PA 1..365 1..365 1730 94.5 Plus
Dere\GG18387-PA 341 GG18387-PA 40..341 61..364 1027 68.1 Plus
Dere\GG15091-PA 243 GG15091-PA 23..235 136..364 158 27.4 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2014-11-28 08:36:33
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH18310-PA 366 GH18310-PA 1..366 1..364 1241 66.5 Plus
Dgri\GH17920-PA 341 GH17920-PA 36..340 61..362 906 61.3 Plus
Dgri\GH15378-PA 243 GH15378-PA 23..236 136..365 154 27.2 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 08:36:29
Subject Length Description Subject Range Query Range Score Percent Strand
CG1287-PA 365 CG1287-PA 1..365 1..365 1873 100 Plus
CG2076-PB 341 CG2076-PB 34..341 55..364 1089 67.1 Plus
CG2076-PA 341 CG2076-PA 34..341 55..364 1089 67.1 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2014-11-28 08:36:35
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI24122-PA 367 GI24122-PA 1..367 1..365 1259 69.5 Plus
Dmoj\GI16063-PA 334 GI16063-PA 46..334 72..363 917 61.6 Plus
Dmoj\GI12982-PA 244 GI12982-PA 23..236 136..365 157 27.2 Plus
Blast to dper-all-translation-r1.3.fasta performed 2014-11-28 08:36:36
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL12174-PA 366 GL12174-PA 1..366 1..365 1353 76.3 Plus
Dper\GL18256-PA 338 GL18256-PA 27..338 53..364 1018 63.5 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2014-11-28 08:36:38
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA11871-PA 366 GA11871-PA 1..366 1..365 1353 76.3 Plus
Dpse\GA28022-PA 338 GA28022-PA 27..338 53..364 1018 63.5 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2014-11-28 08:36:39
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM10478-PA 365 GM10478-PA 1..365 1..365 1783 97.3 Plus
Dsec\GM11453-PA 341 GM11453-PA 34..341 55..364 1025 66.8 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2014-11-28 08:36:40
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD19479-PA 365 GD19479-PA 1..365 1..365 1779 96.7 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2014-11-28 08:36:41
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ10944-PA 369 GJ10944-PA 1..368 1..365 1198 69.6 Plus
Dvir\GJ15635-PA 337 GJ15635-PA 34..337 61..363 970 61.2 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2014-11-28 08:36:43
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK12014-PA 361 GK12014-PA 1..360 1..365 1337 75.2 Plus
Dwil\GK19984-PA 334 GK19984-PA 4..334 33..362 972 59.2 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2014-11-28 08:36:44
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE25789-PA 365 GE25789-PA 1..365 1..365 1788 95.3 Plus
Dyak\GE15904-PA 339 GE15904-PA 34..339 55..364 1007 66.1 Plus

MIP04261.hyp Sequence

Translation from 116 to 1213

> MIP04261.hyp
MLLARLNHVLSGRPMRLLGQSGCPRLWSSAHAQMNSNSLRTPSLAQGKSV
IPKRNMQELGMRKYSRESRDRDRSQLESRTRGPSLKERMMGPPSENAYSM
GKGAAAGAALMGLVGLCYYGLGLANQPSIYDHSMVWPQYVRDRIHATYAY
FGASCGVTAASAVAFFQSDAMMALMTRSGWVASLVTLGLVMLSGSIAQGL
EYQPGFGAKQLAWLVHCAVLGAVLAPMCLLGGPILTKALLYTSGIVGALS
TVAACAPSEKFLHMGGPLAIGLGVVFASSLASMWLPPTTAVGAGLASMSL
YGGLILFSGFLLYDTQRIVKSAELYPQYSKFPYDPINHALAIYMDALNIF
IRIAIILAGDQKRKN*

MIP04261.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 14:11:30
Subject Length Description Subject Range Query Range Score Percent Strand
CG1287-PA 365 CG1287-PA 1..365 1..365 1873 100 Plus
CG2076-PB 341 CG2076-PB 34..341 55..364 1089 67.1 Plus
CG2076-PA 341 CG2076-PA 34..341 55..364 1089 67.1 Plus