Clone MIP04264 Report

Search the DGRC for MIP04264

Clone and Library Details

Library:MIP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by:
Date Registered:2008-10-08
Comments:
Original Plate Number:42
Well:64
Vector:pOT2
Associated Gene/TranscriptCG12913-RA
Protein status:MIP04264.pep: gold
Sequenced Size:1929

Clone Sequence Records

MIP04264.complete Sequence

1929 bp assembled on 2009-04-09

GenBank Submission: BT082032.1

> MIP04264.complete
TTGCCGGAAAATCGATAACTGTTTCCATGGCACGCGCATCTTAAGCAAAA
ACGCTGAATGTAAATAAATGGCTCTGTCCGCGAAACGTTTCCATAAAACT
TCGGTGGACTTGATGGGTCCGGTTAAAGTGTTGAAAATTTTGTAAGAAAC
TATGGAAAATGCATAACTCCCTGGTGACCAAGTTGCTGCTGCGGCTTTTG
CTGCTCTTCGCCTTGTTGACCGGCGCCTCCATTGTGGTGCTCACAAAGTG
CGGATTCGATGAACTGACGACGAGGGAAACTCAAGCCAATAATCCGAGTG
AATCCAGCGGATTCAGTTACACCTTAAGCGAACGAGAGGCGGAAATTGAG
CGGCTGAAACAGGAAGTCCTGGCTCTCCGCACTCAAATCCTCTTTCTACA
GAATAATCGCAGCACTGCCAAGCCATCAAATGGCAGTCTTCAATTGCAAG
AAACCACCGCGGGGCCACCAACTGCACCACTGGGTCACCATTACGACTGC
AGCAGCTATATTCGCAAGCAGGTGGGCGCCGCAGAAATTCTGCATGGACT
GCCGCTGAACAACGAGTACGAGCTGATACCCTACAATCACTTCACCTTCA
CGCGAGTATATCCCATCGACTTGGGCCTGGGAAAGCGCGTGGTGGAGAAG
CCCATCGGTTATCGACGACGTGACCTCATCGAGGCGGTAAACAAGGCGCT
GGAGAGCCTGAACAGGAATCACTCAGCGAGAATACGAGCCAAGGGAGCTG
GTTCTGCAGCGGCTTACGCCTCGGATGTGATCAAATACACCCTGGATGAC
TTTATCGAGGGCATATACCGCAACGAACCCACCACAGGCACCCAGTACGA
GCTGTACTTCCAGAGTGTCAAGCACCAGGCGAGTCCAGTGCGGAGAGCCC
TGGTCATGCGACCATTTGCTCCTCTGCAAACGGTGCAGCTATCGGAGCTA
TCTTCCAGTGTGGATAATAGTGGTGCCCCTCCAAGTCATAGTCCGCCCAT
AATCCACGTGATACTACCGCTGGCTGGACGTCTGCACAGCTTTCGCGGCT
TCCTGCAGATGTTCGCCAAGCTAGAGGATCGTCGCCTGGAGCTTATTGTG
GTGTACTTTGGAACCAGTGGATTGGAGCAAGCTAGGAGCCTGGCTGGACG
ATCCCAAAGGACTCAGTTTTTGGCACTCAATGAGACTTTCAGTAGGGCCA
AAGCTTTAAGACTGGGAGCGGAGCACATTCAACCCGCTGAGGAGGACGTG
CTGCTCTTCATGTGCGACGTGGACATTATGTTCACGACCAAGTTCCTGGA
GCGTTGTCGCTGGAATGCAGCGCCTGGAAAGAAGGTCTACTACCCCGTCG
TATTTAGCCTGTACAATCCGCATGTGGTGTACTCACTGCAGGGCAAGCCC
TTGCCCAGCGAAGAGGAGCAACTGGTGATATCGAGGGACACCGGTTTCTG
GCGGGACTTTGGCTACGGAATGACGTGCCAGTACCGCTCGAACTTCCTAA
AGGTGCGCGGTTTCGACGAGGAGGAGATTGTCGGTTGGGGCGGCGAGGAT
GTGATGCTATACCGAAAGTATGTTCGATCAAAAATCAAGATAATCAGGGC
CACCGACCCGGGAATCTTTCACCGCTGGCACACCAAGATCTGTTCCAGTT
CCCTGACAGCCGATCAGTATCGGGCCTGCATTCGATCGAGGGCCTTGAAT
GAGGCCTCGCACGCCCAACTGGGATTCCTGGCTTTCCGGGATGATATAGC
CGCGGCTAATGCGGCAAAGATGACATCGTGATACTCGACTATTCCCCATG
TATCCCCAATCGCTTGGCTTCTCTACTTAAGTGTGTGTGAATGGAGAGCA
GTGATATAGTTGAAATGTCTAGGGTTTTCTAACAATTATAGCTTTTATTC
CATTTCGTTTTAAAAAAAAAAAAAAAAAA

MIP04264.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 21:30:07
Subject Length Description Subject Range Query Range Score Percent Strand
CG12913-RA 1991 CG12913-RA 56..1967 1..1912 9560 100 Plus
Syb-RA 948 Syb-RA 851..948 131..34 490 100 Minus
Syb-RC 1017 Syb-RC 920..1017 131..34 490 100 Minus
Blast to d_melanogaster_OreR.fa performed 2014-11-26 19:58:36
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 6140491..6141558 130..1197 5235 99.3 Plus
chr2R 21145070 chr2R 6141868..6142172 1333..1637 1450 98.4 Plus
chr2R 21145070 chr2R 6142232..6142507 1636..1911 1305 98.2 Plus
chr2R 21145070 chr2R 6141672..6141811 1197..1336 685 99.3 Plus
chr2R 21145070 chr2R 6136838..6136968 1..131 655 100 Plus
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 19:58:32
Subject Length Description Subject Range Query Range Score Percent Strand
CG12913-RB 1623 CG12913-PB 1..1623 159..1781 8115 100 Plus
CG12913-RA 1623 CG12913-PA 1..1623 159..1781 8115 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 20:03:04 has no hits.
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 19:58:31
Subject Length Description Subject Range Query Range Score Percent Strand
CG12913-RB 2523 CG12913-RB 92..2002 1..1911 9555 100 Plus
CG12913-RA 2002 CG12913-RA 92..2002 1..1911 9555 100 Plus
CG12914-RC 1251 CG12914-RC 1158..1251 1..94 470 100 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-26 19:58:34
Subject Length Description Subject Range Query Range Score Percent Strand
CG12913-PB 540 CG12913-PB 1..540 159..1778 2472 100 Plus
CG12913-PA 540 CG12913-PA 1..540 159..1778 2472 100 Plus
CG9220-PD 832 CG9220-PD 534..792 1023..1694 280 31.1 Plus
CG9220-PC 832 CG9220-PC 534..792 1023..1694 280 31.1 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 19:58:28
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 10252958..10254025 130..1197 5340 100 Plus
2R 25286936 2R 10254335..10254639 1333..1637 1525 100 Plus
2R 25286936 2R 10254699..10254975 1636..1912 1385 100 Plus
2R 25286936 2R 10254139..10254278 1197..1336 700 100 Plus
2R 25286936 2R 10249311..10249441 1..131 655 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:46:41
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 10254157..10255224 130..1197 5340 100 Plus
2R 25260384 2R 10255534..10255838 1333..1637 1525 100 Plus
2R 25260384 2R 10255898..10256174 1636..1912 1385 100 Plus
2R 25260384 2R 10255338..10255477 1197..1336 700 100 Plus
2R 25260384 2R 10250510..10250640 1..131 655 100 Plus
Blast to na_te.dros performed 2014-11-26 19:58:29
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\Het-A 6610 Dvir\Het-A HETAVIR 6610bp 3983..4015 277..309 120 84.8 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6880..6948 219..151 120 63.8 Minus
gypsy12 10218 gypsy12 GYPSY12 10218bp 667..716 233..184 114 74.5 Minus
gypsy12 10218 gypsy12 GYPSY12 10218bp 8549..8598 233..184 114 74.5 Minus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2610..2646 218..182 113 78.4 Minus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6824..6860 218..182 113 78.4 Minus

MIP04264.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2014-11-26 22:03:05 Download gff for MIP04264.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 6142234..6142507 1638..1911 98   Plus
chr2R 6141870..6142172 1335..1637 98 -> Plus
chr2R 6141673..6141809 1198..1334 99 -> Plus
chr2R 6140491..6141558 130..1197 99 -> Plus
chr2R 6136838..6136966 1..129 100 -> Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2009-10-19 18:09:22 Download gff for MIP04264.complete
Subject Subject Range Query Range Percent Splice Strand
CG12913-RA 1..1623 159..1781 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 21:45:03 Download gff for MIP04264.complete
Subject Subject Range Query Range Percent Splice Strand
CG12913-RA 1..1623 159..1781 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 02:33:58 Download gff for MIP04264.complete
Subject Subject Range Query Range Percent Splice Strand
CG12913-RA 1..1623 159..1781 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 22:03:05 Download gff for MIP04264.complete
Subject Subject Range Query Range Percent Splice Strand
CG12913-RA 1..1623 159..1781 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2009-04-10 11:30:03 Download gff for MIP04264.complete
Subject Subject Range Query Range Percent Splice Strand
CG12913-RA 56..1836 1..1781 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 21:45:03 Download gff for MIP04264.complete
Subject Subject Range Query Range Percent Splice Strand
CG12913-RA 55..1965 1..1911 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 02:33:58 Download gff for MIP04264.complete
Subject Subject Range Query Range Percent Splice Strand
CG12913-RA 92..2002 1..1911 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 22:03:05 Download gff for MIP04264.complete
Subject Subject Range Query Range Percent Splice Strand
CG12913-RA 92..2002 1..1911 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 22:03:05 Download gff for MIP04264.complete
Subject Subject Range Query Range Percent Splice Strand
2R 10254701..10254974 1638..1911 100   Plus
2R 10254337..10254639 1335..1637 100 -> Plus
2R 10254140..10254276 1198..1334 100 -> Plus
2R 10252958..10254025 130..1197 100 -> Plus
2R 10249311..10249439 1..129 100 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 02:33:58 Download gff for MIP04264.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 6142206..6142479 1638..1911 100   Plus
arm_2R 6141842..6142144 1335..1637 100 -> Plus
arm_2R 6141645..6141781 1198..1334 100 -> Plus
arm_2R 6140463..6141530 130..1197 100 -> Plus
arm_2R 6136816..6136944 1..129 100 -> Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 19:20:16 Download gff for MIP04264.complete
Subject Subject Range Query Range Percent Splice Strand
2R 10255900..10256173 1638..1911 100   Plus
2R 10255536..10255838 1335..1637 100 -> Plus
2R 10255339..10255475 1198..1334 100 -> Plus
2R 10254157..10255224 130..1197 100 -> Plus
2R 10250510..10250638 1..129 100 -> Plus

MIP04264.pep Sequence

Translation from 158 to 1780

> MIP04264.pep
MHNSLVTKLLLRLLLLFALLTGASIVVLTKCGFDELTTRETQANNPSESS
GFSYTLSEREAEIERLKQEVLALRTQILFLQNNRSTAKPSNGSLQLQETT
AGPPTAPLGHHYDCSSYIRKQVGAAEILHGLPLNNEYELIPYNHFTFTRV
YPIDLGLGKRVVEKPIGYRRRDLIEAVNKALESLNRNHSARIRAKGAGSA
AAYASDVIKYTLDDFIEGIYRNEPTTGTQYELYFQSVKHQASPVRRALVM
RPFAPLQTVQLSELSSSVDNSGAPPSHSPPIIHVILPLAGRLHSFRGFLQ
MFAKLEDRRLELIVVYFGTSGLEQARSLAGRSQRTQFLALNETFSRAKAL
RLGAEHIQPAEEDVLLFMCDVDIMFTTKFLERCRWNAAPGKKVYYPVVFS
LYNPHVVYSLQGKPLPSEEEQLVISRDTGFWRDFGYGMTCQYRSNFLKVR
GFDEEEIVGWGGEDVMLYRKYVRSKIKIIRATDPGIFHRWHTKICSSSLT
ADQYRACIRSRALNEASHAQLGFLAFRDDIAAANAAKMTS*

MIP04264.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2014-11-28 08:50:28
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF12786-PA 537 GF12786-PA 1..536 1..539 2469 86.7 Plus
Dana\GF22250-PA 818 GF22250-PA 453..784 236..512 326 30.2 Plus
Blast to dere-all-translation-r1.3.fasta performed 2014-11-28 08:50:29
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG24153-PA 540 GG24153-PA 1..540 1..540 2661 96.3 Plus
Dere\GG19389-PA 831 GG19389-PA 506..792 261..512 315 30.7 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2014-11-28 08:50:31
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH21775-PA 564 GH21775-PA 1..550 1..530 1995 70.2 Plus
Dgri\GH11859-PA 824 GH11859-PA 530..790 282..512 304 30.5 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 08:50:26
Subject Length Description Subject Range Query Range Score Percent Strand
CG12913-PB 540 CG12913-PB 1..540 1..540 2782 100 Plus
CG12913-PA 540 CG12913-PA 1..540 1..540 2782 100 Plus
CG9220-PD 832 CG9220-PD 506..792 261..512 297 30.5 Plus
CG9220-PC 832 CG9220-PC 506..792 261..512 297 30.5 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2014-11-28 08:50:34
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI19322-PA 552 GI19322-PA 1..550 1..535 2049 71 Plus
Dmoj\GI15636-PA 825 GI15636-PA 512..791 260..512 325 30.2 Plus
Blast to dper-all-translation-r1.3.fasta performed 2014-11-28 08:50:36
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL11584-PA 539 GL11584-PA 1..539 1..540 2262 81.7 Plus
Dper\GL16444-PA 831 GL16444-PA 517..792 271..512 304 30.6 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2014-11-28 08:50:38
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA11904-PA 539 GA11904-PA 1..539 1..540 2216 81.2 Plus
Dpse\GA22578-PA 830 GA22578-PA 517..792 271..512 307 30.6 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2014-11-28 08:50:39
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM21196-PA 540 GM21196-PA 1..540 1..540 2750 98 Plus
Dsec\GM20871-PA 275 GM20871-PA 1..249 1..282 1022 78.9 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2014-11-28 08:50:41
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD10724-PA 540 GD10724-PA 1..540 1..540 2852 98.5 Plus
Dsim\GD15794-PA 831 GD15794-PA 460..792 238..512 311 30.5 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2014-11-28 08:50:43
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ22200-PA 553 GJ22200-PA 1..543 1..535 2046 72.8 Plus
Dvir\GJ19224-PA 825 GJ19224-PA 512..791 260..512 335 32 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2014-11-28 08:50:44
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK17784-PA 557 GK17784-PA 1..541 1..533 2131 72.3 Plus
Dwil\GK25624-PA 836 GK25624-PA 503..794 253..512 309 29.8 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2014-11-28 08:50:46
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE19348-PA 540 GE19348-PA 1..540 1..540 2695 95.2 Plus
Dyak\GE16036-PA 835 GE16036-PA 460..792 238..512 313 30.4 Plus

MIP04264.hyp Sequence

Translation from 158 to 1780

> MIP04264.hyp
MHNSLVTKLLLRLLLLFALLTGASIVVLTKCGFDELTTRETQANNPSESS
GFSYTLSEREAEIERLKQEVLALRTQILFLQNNRSTAKPSNGSLQLQETT
AGPPTAPLGHHYDCSSYIRKQVGAAEILHGLPLNNEYELIPYNHFTFTRV
YPIDLGLGKRVVEKPIGYRRRDLIEAVNKALESLNRNHSARIRAKGAGSA
AAYASDVIKYTLDDFIEGIYRNEPTTGTQYELYFQSVKHQASPVRRALVM
RPFAPLQTVQLSELSSSVDNSGAPPSHSPPIIHVILPLAGRLHSFRGFLQ
MFAKLEDRRLELIVVYFGTSGLEQARSLAGRSQRTQFLALNETFSRAKAL
RLGAEHIQPAEEDVLLFMCDVDIMFTTKFLERCRWNAAPGKKVYYPVVFS
LYNPHVVYSLQGKPLPSEEEQLVISRDTGFWRDFGYGMTCQYRSNFLKVR
GFDEEEIVGWGGEDVMLYRKYVRSKIKIIRATDPGIFHRWHTKICSSSLT
ADQYRACIRSRALNEASHAQLGFLAFRDDIAAANAAKMTS*

MIP04264.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:30:45
Subject Length Description Subject Range Query Range Score Percent Strand
CG12913-PB 540 CG12913-PB 1..540 1..540 2782 100 Plus
CG12913-PA 540 CG12913-PA 1..540 1..540 2782 100 Plus
CG9220-PD 832 CG9220-PD 506..792 261..512 297 30.5 Plus
CG9220-PC 832 CG9220-PC 506..792 261..512 297 30.5 Plus