Clone MIP04331 Report

Search the DGRC for MIP04331

Clone and Library Details

Library:MIP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by:
Date Registered:2008-10-08
Comments:
Original Plate Number:43
Well:31
Vector:pOT2
Associated Gene/TranscriptCG11423-RA
Protein status:MIP04331.pep: gold
Sequenced Size:2151

Clone Sequence Records

MIP04331.complete Sequence

2151 bp assembled on 2009-07-24

GenBank Submission: BT088950.1

> MIP04331.complete
CGAAAGCATGATATCGTTTCTGTTAAAACGCCGAGCTTGTGATGCTTACA
AGATTTCATTAGGACTAACTCGTGCATATAGAGCCTTAACAGAAGTAAAA
AGCCTTCAAAATGCCTTACGACCTGGTAATAAAACTGGAAATATCAAGCT
GGTAAACATATACCGAACTTCTAGCATACAAAATGTGAAGAAGAACCAAC
TAAGTGACGCTGAAAGCGTTATTCCACTCTTATTGCGGCCAGCCAAACCT
GTGCTGATTATGAGAGAAGGATCTCAAACCGATTGTAACGACGATTTGCT
GTCCTCTGAGCAAAGAGCCAAAAAAAGGGAAAGCATAAAAAAATCCGAAG
TAGATTGCCCAAAATTTCCAGCTGAGAAACTTCCGCCCACAACGAAATTT
CCTATTAATGAAAATGCCAAGAAGGTTTTAGATCCAGCCGACCAAAGAGA
ACTCGAGGCCAATTTGTTAAAAAGGCTTAAAGATATGGCTAAAAGAAAGA
AATCTCGACTAGATGAGAAAGTTGACGAGCTGAGGGATAATTTTATAGGC
TGGAATTATGCTGCTCTACAAGGAAGAACTATTGTGACTGTGGATGCCAA
GGAATCAACTCCACCGAAAGGATCTGGGCCGGCCACCCCGGCAGGCTCTC
CTCCACCTAAAAATGTTTCTGCACCGCCGACGGGCGGTTCTCCGCCTGCC
AAAAGCGGCGCTCCACCACCCCCAAAGGGGCCACCGCCCGGAACTCCACC
ACCGCAGACGAAAACTACTTTTGGACCACTTGCTGATGCTGATCGAATCT
TTACCAATTTATACGGACGGCACGATTGGCGATTGAAGGCAGCAATGAAG
CGCGGTGACTGGTACAAGACGAAGGAGATCATAGCCAAGGGTGACAAGTG
GATAGTCAACGAGATTAAGACATCTGGACTGCGAGGACGCGGTGGCGCCG
GATTTCCCAGTGGACTTAAGTGGTCATTTATGCATAAACCGCCTGATGGA
AGACCCAAGTTTCTGGTGGTCAATGCGGATGAAGGAGAGCCCGGTACTTG
CAAGGATCGTGAGATAATGCGCCATGATCCACACAAACTGGTAGAGGGAT
GTCTCATTGCTGGACGGGCTATGGGTGCCAACACTGGTTTTATTTACATT
CGCGGAGAGTTTTACAACGAAGCTTGCAATCTTCAGTATGCCATTATTGA
GGCCTATAAGGCTGGCTACCTGGGAAAGAATGCCTGCGGTTCTGGGTTCG
ATTTCGATCTTTATGTGCAACGTGGAGCAGGAGCCTATATTTGCGGTGAG
GAAACCTCTCTGATTGAATCCCTGGAGGGCAAGGCGGGTAAGCCAAGGAA
CAAGCCTCCCTTTCCGGCTGATATCGGCGTCTTTGGCTGTCCGTCTACGG
TGACCAATGTGGAAACGGTGGCCGTGTCTCCCACTATTTGCCGGCGTGGT
GGCAATTGGTTTGCCAGCTTTGGACGTACCCGAAACTCTGGCACCAAGCT
GTTTAATATCTCTGGTCATGTTTGCAACCCTTGTACCGTCGAGGAGGAGA
TGTCCATGCCAACCAGAGAGCTTATCGAACGCCATGCTGGCGGAGTGATC
GGGGGCTGGGACAATCTACTGGCCATCATTCCGGGTGGCTCCTCCACTCC
CTGCATTACCAAGGAGCACGCCTCGAGTGCGATTCACGACTACGATGGGC
TGATGGCAGTGCGTTCGTCCATGGGAACGGGTGCCTTAATTGTTATGAAT
AAGGATACGGACATTATCAAGGCCATTGCCCGATTATCGGCTTTCTATAA
GCACGAGAGCTGCGGCCAGTGCACTCCTTGCCGCGAGGGTCTCCACTGGG
TGAACATGATCATGCATAGATTTGTGACAGGACAGGCGCAAATTGCAGAG
ATCGATATGCTGTTCGAACTGACGAAGCAGATCGAGGGACATACCATTTG
TGCCCTGGCCGATGGTGCTGCTTGGCCGCCCCAAGGACTCATCCGGAACT
TCCGACCGGTCATCGAGGAGAGGATCAAGAAGCGGGCGGCCGAGGACCAA
GCTAAAGCTGAAGCACTCGAAGCCGAACGTTTCCCTTGTCAAACGGTGAC
TCCTTGTCCAGAATAAAGCGTGCCAGTTGCATCAAAAAAAAAAAAAAAAA
A

MIP04331.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 16:31:49
Subject Length Description Subject Range Query Range Score Percent Strand
CG11423-RA 2143 CG11423-RA 11..2143 1..2133 10665 100 Plus
CG9140-RA 1714 CG9140-RA 382..662 899..1179 490 78.2 Plus
CG9140-RA 1714 CG9140-RA 706..1044 1223..1561 405 74.6 Plus
CG9140-RA 1714 CG9140-RA 214..362 731..879 205 75.8 Plus
CG9140-RA 1714 CG9140-RA 1276..1358 1793..1875 175 80.7 Plus
CG8102-RB 1509 CG8102-RB 420..481 1034..1095 160 83.8 Plus
CG9140-RA 1714 CG9140-RA 1381..1500 1898..2017 150 75 Plus
CG8102-RB 1509 CG8102-RB 924..1000 1541..1617 145 79.2 Plus
Blast to d_melanogaster_OreR.fa performed 2014-11-26 20:20:06
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 13482335..13484467 1..2133 10530 99.6 Plus
chr2L 23010047 chr2L 6060456..6061074 1651..1033 710 74.3 Minus
chr2L 23010047 chr2L 6061125..6061433 1039..731 315 73.5 Minus
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 20:20:01
Subject Length Description Subject Range Query Range Score Percent Strand
CG11423-RA 2109 CG11423-PA 1..2109 8..2116 10545 100 Plus
CG9140-RB 1425 CG9140-PB 100..1386 731..2017 1035 72 Plus
CG9140-RA 1425 CG9140-PA 100..1386 731..2017 1035 72 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 20:03:09 has no hits.
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 20:20:00
Subject Length Description Subject Range Query Range Score Percent Strand
CG11423-RA 2143 CG11423-RA 11..2143 1..2133 10665 100 Plus
CG9140-RB 1553 CG9140-RB 133..1419 731..2017 1035 72 Plus
CG9140-RA 1590 CG9140-RA 170..1456 731..2017 1035 72 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-26 20:20:04
Subject Length Description Subject Range Query Range Score Percent Strand
CG11423-PA 702 CG11423-PA 1..702 8..2113 3359 100 Plus
CG9140-PB 474 CG9140-PB 50..469 779..2038 1842 79.5 Plus
CG9140-PA 474 CG9140-PA 50..469 779..2038 1842 79.5 Plus
CG8102-PA 481 CG8102-PA 58..478 779..2038 1155 51.7 Plus
CG8102-PB 462 CG8102-PB 58..459 779..2038 1052 48.3 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 20:19:58
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 17595277..17597413 1..2137 10685 100 Plus
2L 23513712 2L 6061405..6062023 1651..1033 710 74.3 Minus
2L 23513712 2L 6062074..6062382 1039..731 315 73.5 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 18:27:47
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 17596476..17598612 1..2137 10685 100 Plus
2L 23513712 2L 6061495..6061833 1561..1223 405 74.6 Minus
2L 23513712 2L 6061877..6062023 1179..1033 330 81.6 Minus
2L 23513712 2L 6062234..6062382 879..731 205 75.8 Minus
2L 23513712 2L 6061192..6061263 1864..1793 165 81.9 Minus
2R 25260384 2R 15298991..15299052 1095..1034 160 83.8 Minus
2R 25260384 2R 15298472..15298548 1617..1541 145 79.2 Minus
Blast to na_te.dros performed on 2014-11-26 20:19:59 has no hits.

MIP04331.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2014-11-26 21:26:42 Download gff for MIP04331.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 13482335..13484467 1..2133 99   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2009-10-19 18:11:48 Download gff for MIP04331.complete
Subject Subject Range Query Range Percent Splice Strand
CG11423-RA 1..2109 8..2116 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 14:00:08 Download gff for MIP04331.complete
Subject Subject Range Query Range Percent Splice Strand
CG11423-RA 1..2109 8..2116 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 01:02:12 Download gff for MIP04331.complete
Subject Subject Range Query Range Percent Splice Strand
CG11423-RA 1..2109 8..2116 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 21:26:42 Download gff for MIP04331.complete
Subject Subject Range Query Range Percent Splice Strand
CG11423-RA 1..2109 8..2116 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2009-07-24 15:11:04 Download gff for MIP04331.complete
Subject Subject Range Query Range Percent Splice Strand
CG11423-RA 11..2126 1..2116 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 14:00:08 Download gff for MIP04331.complete
Subject Subject Range Query Range Percent Splice Strand
CG11423-RA 11..2143 1..2133 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 01:02:12 Download gff for MIP04331.complete
Subject Subject Range Query Range Percent Splice Strand
CG11423-RA 11..2143 1..2133 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 21:26:42 Download gff for MIP04331.complete
Subject Subject Range Query Range Percent Splice Strand
CG11423-RA 11..2143 1..2133 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 21:26:42 Download gff for MIP04331.complete
Subject Subject Range Query Range Percent Splice Strand
2R 17595277..17597409 1..2133 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 01:02:12 Download gff for MIP04331.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 13482782..13484914 1..2133 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 11:51:52 Download gff for MIP04331.complete
Subject Subject Range Query Range Percent Splice Strand
2R 17596476..17598608 1..2133 100   Plus

MIP04331.hyp Sequence

Translation from 0 to 2115

> MIP04331.hyp
ESMISFLLKRRACDAYKISLGLTRAYRALTEVKSLQNALRPGNKTGNIKL
VNIYRTSSIQNVKKNQLSDAESVIPLLLRPAKPVLIMREGSQTDCNDDLL
SSEQRAKKRESIKKSEVDCPKFPAEKLPPTTKFPINENAKKVLDPADQRE
LEANLLKRLKDMAKRKKSRLDEKVDELRDNFIGWNYAALQGRTIVTVDAK
ESTPPKGSGPATPAGSPPPKNVSAPPTGGSPPAKSGAPPPPKGPPPGTPP
PQTKTTFGPLADADRIFTNLYGRHDWRLKAAMKRGDWYKTKEIIAKGDKW
IVNEIKTSGLRGRGGAGFPSGLKWSFMHKPPDGRPKFLVVNADEGEPGTC
KDREIMRHDPHKLVEGCLIAGRAMGANTGFIYIRGEFYNEACNLQYAIIE
AYKAGYLGKNACGSGFDFDLYVQRGAGAYICGEETSLIESLEGKAGKPRN
KPPFPADIGVFGCPSTVTNVETVAVSPTICRRGGNWFASFGRTRNSGTKL
FNISGHVCNPCTVEEEMSMPTRELIERHAGGVIGGWDNLLAIIPGGSSTP
CITKEHASSAIHDYDGLMAVRSSMGTGALIVMNKDTDIIKAIARLSAFYK
HESCGQCTPCREGLHWVNMIMHRFVTGQAQIAEIDMLFELTKQIEGHTIC
ALADGAAWPPQGLIRNFRPVIEERIKKRAAEDQAKAEALEAERFPCQTVT
PCPE*

MIP04331.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:56:28
Subject Length Description Subject Range Query Range Score Percent Strand
CG11423-PA 702 CG11423-PA 1..702 3..704 3738 100 Plus
CG9140-PB 474 CG9140-PB 32..469 242..679 1934 79.7 Plus
CG9140-PA 474 CG9140-PA 32..469 242..679 1934 79.7 Plus
CG8102-PA 481 CG8102-PA 23..478 223..679 1211 51 Plus
CG8102-PB 462 CG8102-PB 23..459 223..679 1108 47.9 Plus

MIP04331.pep Sequence

Translation from 1 to 2115

> MIP04331.pep
ESMISFLLKRRACDAYKISLGLTRAYRALTEVKSLQNALRPGNKTGNIKL
VNIYRTSSIQNVKKNQLSDAESVIPLLLRPAKPVLIMREGSQTDCNDDLL
SSEQRAKKRESIKKSEVDCPKFPAEKLPPTTKFPINENAKKVLDPADQRE
LEANLLKRLKDMAKRKKSRLDEKVDELRDNFIGWNYAALQGRTIVTVDAK
ESTPPKGSGPATPAGSPPPKNVSAPPTGGSPPAKSGAPPPPKGPPPGTPP
PQTKTTFGPLADADRIFTNLYGRHDWRLKAAMKRGDWYKTKEIIAKGDKW
IVNEIKTSGLRGRGGAGFPSGLKWSFMHKPPDGRPKFLVVNADEGEPGTC
KDREIMRHDPHKLVEGCLIAGRAMGANTGFIYIRGEFYNEACNLQYAIIE
AYKAGYLGKNACGSGFDFDLYVQRGAGAYICGEETSLIESLEGKAGKPRN
KPPFPADIGVFGCPSTVTNVETVAVSPTICRRGGNWFASFGRTRNSGTKL
FNISGHVCNPCTVEEEMSMPTRELIERHAGGVIGGWDNLLAIIPGGSSTP
CITKEHASSAIHDYDGLMAVRSSMGTGALIVMNKDTDIIKAIARLSAFYK
HESCGQCTPCREGLHWVNMIMHRFVTGQAQIAEIDMLFELTKQIEGHTIC
ALADGAAWPPQGLIRNFRPVIEERIKKRAAEDQAKAEALEAERFPCQTVT
PCPE*

MIP04331.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2014-11-28 08:08:45
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF15407-PA 477 GF15407-PA 47..471 257..681 1881 78.8 Plus
Dana\GF11875-PA 520 GF11875-PA 67..505 242..679 1179 51.6 Plus
Blast to dere-all-translation-r1.3.fasta performed 2014-11-28 08:08:47
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG10139-PA 474 GG10139-PA 47..469 257..679 1878 79.7 Plus
Dere\GG22361-PA 481 GG22361-PA 23..478 223..679 1214 50.5 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2014-11-28 08:08:48
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH10936-PA 476 GH10936-PA 46..470 257..681 1871 78.6 Plus
Dgri\GH21461-PA 546 GH21461-PA 51..540 191..676 1171 48.8 Plus
Dgri\GH25296-PA 833 GH25296-PA 118..458 252..594 1008 56.6 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 08:08:43
Subject Length Description Subject Range Query Range Score Percent Strand
CG11423-PA 702 CG11423-PA 1..702 3..704 3738 100 Plus
CG9140-PB 474 CG9140-PB 32..469 242..679 1934 79.7 Plus
CG9140-PA 474 CG9140-PA 32..469 242..679 1934 79.7 Plus
CG8102-PA 481 CG8102-PA 23..478 223..679 1211 51 Plus
CG8102-PB 462 CG8102-PB 23..459 223..679 1108 47.9 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2014-11-28 08:08:50
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI13499-PA 476 GI13499-PA 46..472 257..683 1882 78.5 Plus
Dmoj\GI19938-PA 470 GI19938-PA 40..469 226..679 1132 48.7 Plus
Blast to dper-all-translation-r1.3.fasta performed 2014-11-28 08:08:52
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL19080-PA 477 GL19080-PA 32..473 242..683 1900 78.1 Plus
Dper\GL11014-PA 445 GL11014-PA 25..439 242..675 1221 53.1 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2014-11-28 08:08:53
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA30486-PA 648 GA30486-PA 6..638 7..678 2238 66.4 Plus
Dpse\GA21571-PA 477 GA21571-PA 32..473 242..683 1901 78.1 Plus
Dpse\GA20825-PA 445 GA20825-PA 25..439 242..675 1216 53.1 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2014-11-28 08:08:55
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM17964-PA 435 GM17964-PA 36..430 257..679 1548 70.2 Plus
Dsec\GM20146-PA 481 GM20146-PA 49..478 251..679 1202 51.7 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2014-11-28 08:08:57
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD22602-PA 499 GD22602-PA 47..494 257..679 1651 68.3 Plus
Dsim\GD25625-PA 481 GD25625-PA 49..478 251..679 1201 51.7 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2014-11-28 08:08:59
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ12140-PA 476 GJ12140-PA 46..472 257..683 1890 78.9 Plus
Dvir\GJ15106-PA 501 GJ15106-PA 48..498 227..682 1209 52 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2014-11-28 08:09:00
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK15392-PA 478 GK15392-PA 47..476 257..686 1880 78.1 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2014-11-28 08:09:01
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE18950-PA 474 GE18950-PA 47..469 257..679 1874 79.4 Plus
Dyak\GE12249-PA 481 GE12249-PA 23..478 223..679 1216 50.5 Plus