Clone MIP04335 Report

Search the DGRC for MIP04335

Clone and Library Details

Library:MIP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by:
Date Registered:2008-10-08
Comments:
Original Plate Number:43
Well:35
Vector:pOT2
Associated Gene/TranscriptCG5946-RB
Protein status:MIP04335.pep: gold
Sequenced Size:1451

Clone Sequence Records

MIP04335.complete Sequence

1451 bp assembled on 2009-05-01

GenBank Submission: BT082110.1

> MIP04335.complete
ATAAAATCTATATATGCAACTAGTTAGTTACTGTGTGTCTGAAGATTCTG
TTGATTATAGGCTTTCTTCTCTTTCTTCTTTTCTTTCTAGGTGATATCAT
AGTGTGTTCAAGAGAGGCAAAGAGAAACTCTCTTGCGCTCTCTCCTTAAA
ACGGAGAGTGCGTGGAAATGAAAACATTGCTTTCACCATCTCGCCGATTA
GTCTGCATATCAGTGTTTAGTCGGCTTTTCGCTTTCGTTAGATAAAAATT
AAGTGCGTGGTGTCGTTGCAATTCGCGGATTATATAAGGGATTTGAGCCG
CGACTGCATTGATTTTCCATTGGCCATGGCCCGCATCGTTGAAAGCAATT
TTGTGCCACTCGCCGTGGGTGTGGTAGCCGTACTCGCCGGCGCCCTGATC
GTCCACTATCTGCTGAATAAGAAGTCCACGAAACCACGCCGGGAACCCAA
TCGCACCGCTCGGCTGCGCACACTTGTGGATCCCAATGACAAGTACCTGC
TGCCTCTCATCGAAAAGGAGAATCTGAGCCATGACACTAGGAGATTCCGG
TTTGGATTGCCCTCCAAGCAGCATGTCCTTGGCCTGCCCGTTGGCCAGCA
CATTCATCTGATCGCCACCATCGACAATGAGCTAATAATTCGGCCATACA
CTCCGATATCGTCTGATGAGGATGTGGGCTACGTGGACCTAGTCGTCAAG
GTGTACTTCAAGGATTCGCATCCCAAGTTCCCGGCCGGCGGCAAAATGAC
ACAACACCTGGAGCAGCTCGAGTTGGGGGACAAGATCTCGTTCCGTGGTC
CCTCGGGTAGGCTACAATATCTCGGCAATGGCACCTTCTCCATCAAAAAG
TTGCGCAAGGATCCTCCAAAGCACGTGACCGCCAAGCGGGTCAACATGAT
TGCCGGCGGCACTGGCATTACTCCAATGCTTCAATTGGCCAGGGAAGTTC
TCAAGCGCAGCGATAAGGATAAGACTGAACTGGCGTTGCTGTTCGCCAAT
CAGAGCGAAAAGGACATTCTACTGCGTGCAGAGTTGGACGAACTGGCCCA
GAAGCATCCTGACCAGTTCAAGATCTGGTACACAGTCGACAAGGCAAACG
AAGGTTGGCAGTATAGCGTTGGCTTCATCAATGAGGAAATGATCGCCGCC
CACCTGCTTCCGGCCAAGGACGATACCATTGTGTTGCTTTGCGGCCCACC
ACCCATGATTAACTTTGCCTGCAATCCGGCGCTGGACAAGCTTGGCTACC
ATCCGGACACCCGTTTTGCCTACTAATATGATGGACATTATGGGACGAAA
TTGCATTTTCGTTGTGTTATATTCCTCTTTTTTTATCTGTTGTCTCTTAC
CAGCCATCCAAGAGTTCGCCAAGATTTCGGCAATGAGATTGAAAACCAAG
CGAATAAAAACATTAATTAGTTTAAAGTTTAAAAAAAAAAAAAAAAAAAA
A

MIP04335.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 16:25:03
Subject Length Description Subject Range Query Range Score Percent Strand
CG5946-RF 1437 CG5946-RF 1..1354 1..1354 6755 99.9 Plus
CG5946-RB 1398 CG5946-RB 51..1315 90..1354 6310 99.9 Plus
CG5946-RE 2169 CG5946-RE 51..1066 90..1105 5080 100 Plus
CG5946-RE 2169 CG5946-RE 1834..2086 1102..1354 1250 99.6 Plus
CG5946-RF 1437 CG5946-RF 1363..1437 1356..1430 360 98.6 Plus
CG5946-RE 2169 CG5946-RE 2095..2169 1356..1430 360 98.6 Plus
CG5946-RB 1398 CG5946-RB 1324..1398 1356..1430 360 98.6 Plus
Blast to d_melanogaster_OreR.fa performed 2014-11-27 05:25:49
Subject Length Description Subject Range Query Range Score Percent Strand
chr3L 24539361 chr3L 11809124..11809777 1003..350 3270 100 Minus
chr3L 24539361 chr3L 11812703..11813051 349..1 1745 100 Minus
chr3L 24539361 chr3L 11807853..11808188 1430..1102 1510 97.3 Minus
chr3L 24539361 chr3L 11808956..11809059 1105..1002 520 100 Minus
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 05:25:45
Subject Length Description Subject Range Query Range Score Percent Strand
CG5946-RF 951 CG5946-PF 1..951 326..1276 4740 99.9 Plus
CG5946-RB 951 CG5946-PB 1..951 326..1276 4740 99.9 Plus
CG5946-RA 942 CG5946-PA 14..942 348..1276 4630 99.9 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 20:03:10 has no hits.
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 05:25:44
Subject Length Description Subject Range Query Range Score Percent Strand
CG5946-RF 1460 CG5946-RF 24..1460 1..1430 7000 99.3 Plus
CG5946-RB 1686 CG5946-RB 51..1398 90..1430 6555 99.3 Plus
CG5946-RA 1224 CG5946-RA 135..1224 348..1430 5265 99.1 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 05:25:47
Subject Length Description Subject Range Query Range Score Percent Strand
CG5946-PF 316 CG5946-PF 1..316 326..1273 1579 100 Plus
CG5946-PB 316 CG5946-PB 1..316 326..1273 1579 100 Plus
CG5946-PA 313 CG5946-PA 1..313 335..1273 1547 98.7 Plus
CG5946-PD 316 CG5946-PD 1..316 326..1273 1444 90.5 Plus
CG5946-PG 330 CG5946-PG 1..330 326..1273 1419 86.7 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 05:25:42
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 11818254..11818907 1003..350 3270 100 Minus
3L 28110227 3L 11821834..11822182 349..1 1745 100 Minus
3L 28110227 3L 11816980..11817318 1433..1102 1510 97.1 Minus
3L 28110227 3L 11818086..11818189 1105..1002 520 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 18:19:25
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28103327 3L 11811354..11812007 1003..350 3270 100 Minus
3L 28103327 3L 11814934..11815282 349..1 1745 100 Minus
3L 28103327 3L 11810166..11810418 1354..1102 1250 99.6 Minus
3L 28103327 3L 11811186..11811289 1105..1002 520 100 Minus
3L 28103327 3L 11810080..11810157 1433..1356 375 98.7 Minus
Blast to na_te.dros performed on 2014-11-27 05:25:43 has no hits.

MIP04335.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2014-11-27 06:32:29 Download gff for MIP04335.complete
Subject Subject Range Query Range Percent Splice Strand
chr3L 11812703..11813051 1..349 100   Minus
chr3L 11809124..11809777 350..1003 100 <- Minus
chr3L 11808958..11809057 1004..1103 100 <- Minus
chr3L 11807853..11808186 1104..1430 97 <- Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2009-10-19 17:51:48 Download gff for MIP04335.complete
Subject Subject Range Query Range Percent Splice Strand
CG5946-RB 1..951 326..1276 99   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 13:50:10 Download gff for MIP04335.complete
Subject Subject Range Query Range Percent Splice Strand
CG5946-RF 1..951 326..1276 99   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 08:22:58 Download gff for MIP04335.complete
Subject Subject Range Query Range Percent Splice Strand
CG5946-RB 1..951 326..1276 99   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 06:32:29 Download gff for MIP04335.complete
Subject Subject Range Query Range Percent Splice Strand
CG5946-RB 1..951 326..1276 99   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2009-05-01 09:52:54 Download gff for MIP04335.complete
Subject Subject Range Query Range Percent Splice Strand
CG5946-RB 33..1373 90..1423 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 13:50:10 Download gff for MIP04335.complete
Subject Subject Range Query Range Percent Splice Strand
CG5946-RF 1..1437 1..1430 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 08:22:58 Download gff for MIP04335.complete
Subject Subject Range Query Range Percent Splice Strand
CG5946-RF 1..1437 1..1430 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 06:32:29 Download gff for MIP04335.complete
Subject Subject Range Query Range Percent Splice Strand
CG5946-RF 24..1460 1..1430 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 06:32:29 Download gff for MIP04335.complete
Subject Subject Range Query Range Percent Splice Strand
3L 11821834..11822182 1..349 100   Minus
3L 11818254..11818907 350..1003 100 <- Minus
3L 11818088..11818187 1004..1103 100 <- Minus
3L 11816983..11817316 1104..1430 97 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 08:22:58 Download gff for MIP04335.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 11814934..11815282 1..349 100   Minus
arm_3L 11811354..11812007 350..1003 100 <- Minus
arm_3L 11811188..11811287 1004..1103 100 <- Minus
arm_3L 11810083..11810416 1104..1430 97 <- Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 11:41:05 Download gff for MIP04335.complete
Subject Subject Range Query Range Percent Splice Strand
3L 11814934..11815282 1..349 100   Minus
3L 11811354..11812007 350..1003 100 <- Minus
3L 11811188..11811287 1004..1103 100 <- Minus
3L 11810083..11810416 1104..1430 97 <- Minus

MIP04335.pep Sequence

Translation from 325 to 1275

> MIP04335.pep
MARIVESNFVPLAVGVVAVLAGALIVHYLLNKKSTKPRREPNRTARLRTL
VDPNDKYLLPLIEKENLSHDTRRFRFGLPSKQHVLGLPVGQHIHLIATID
NELIIRPYTPISSDEDVGYVDLVVKVYFKDSHPKFPAGGKMTQHLEQLEL
GDKISFRGPSGRLQYLGNGTFSIKKLRKDPPKHVTAKRVNMIAGGTGITP
MLQLAREVLKRSDKDKTELALLFANQSEKDILLRAELDELAQKHPDQFKI
WYTVDKANEGWQYSVGFINEEMIAAHLLPAKDDTIVLLCGPPPMINFACN
PALDKLGYHPDTRFAY*

MIP04335.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2014-11-28 07:20:07
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF25295-PA 313 GF25295-PA 1..313 4..316 1503 92.7 Plus
Dana\GF12339-PA 534 GF12339-PA 288..527 60..311 186 25.9 Plus
Blast to dere-all-translation-r1.3.fasta performed 2014-11-28 07:20:08
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG12996-PA 384 GG12996-PA 1..384 4..316 1499 77.1 Plus
Dere\GG21968-PA 535 GG21968-PA 297..524 61..307 167 24.7 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2014-11-28 07:20:09
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH14799-PA 316 GH14799-PA 1..316 1..316 1508 91.1 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 07:20:06
Subject Length Description Subject Range Query Range Score Percent Strand
CG5946-PF 316 CG5946-PF 1..316 1..316 1648 100 Plus
CG5946-PB 316 CG5946-PB 1..316 1..316 1648 100 Plus
CG5946-PA 313 CG5946-PA 1..313 4..316 1616 98.7 Plus
CG5946-PD 316 CG5946-PD 1..316 1..316 1513 90.5 Plus
CG5946-PG 330 CG5946-PG 1..330 1..316 1488 86.7 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2014-11-28 07:20:10
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI11853-PA 316 GI11853-PA 1..316 1..316 1526 88 Plus
Dmoj\GI21190-PA 528 GI21190-PA 255..522 26..311 166 25.1 Plus
Blast to dper-all-translation-r1.3.fasta performed 2014-11-28 07:20:11
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL20725-PA 316 GL20725-PA 1..316 1..316 1501 91.1 Plus
Dper\GL10825-PA 536 GL10825-PA 283..529 46..311 173 25.2 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2014-11-28 07:20:12
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA19251-PA 316 GA19251-PA 1..316 1..316 1502 91.5 Plus
Dpse\GA10870-PA 536 GA10870-PA 283..529 46..311 173 25.2 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2014-11-28 07:20:13
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM24706-PA 313 GM24706-PA 1..313 4..316 1634 97.4 Plus
Dsec\GM21957-PA 535 GM21957-PA 290..509 54..291 173 23.9 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2014-11-28 07:20:14
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD12773-PA 316 GD12773-PA 1..316 1..316 1672 99.1 Plus
Dsim\GD11452-PA 535 GD11452-PA 297..509 61..291 173 24.4 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2014-11-28 07:20:15
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ13551-PA 316 GJ13551-PA 1..316 1..316 1528 92.4 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2014-11-28 07:20:16
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK25189-PA 316 GK25189-PA 1..316 1..316 1543 94.6 Plus
Dwil\GK22167-PA 528 GK22167-PA 257..502 26..291 179 26.1 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2014-11-28 07:20:17
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE20176-PA 316 GE20176-PA 1..316 1..316 1633 96.5 Plus
Dyak\GE12047-PA 537 GE12047-PA 303..511 65..291 171 24.3 Plus

MIP04335.hyp Sequence

Translation from 325 to 1275

> MIP04335.hyp
MARIVESNFVPLAVGVVAVLAGALIVHYLLNKKSTKPRREPNRTARLRTL
VDPNDKYLLPLIEKENLSHDTRRFRFGLPSKQHVLGLPVGQHIHLIATID
NELIIRPYTPISSDEDVGYVDLVVKVYFKDSHPKFPAGGKMTQHLEQLEL
GDKISFRGPSGRLQYLGNGTFSIKKLRKDPPKHVTAKRVNMIAGGTGITP
MLQLAREVLKRSDKDKTELALLFANQSEKDILLRAELDELAQKHPDQFKI
WYTVDKANEGWQYSVGFINEEMIAAHLLPAKDDTIVLLCGPPPMINFACN
PALDKLGYHPDTRFAY*

MIP04335.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:14:36
Subject Length Description Subject Range Query Range Score Percent Strand
CG5946-PF 316 CG5946-PF 1..316 1..316 1648 100 Plus
CG5946-PB 316 CG5946-PB 1..316 1..316 1648 100 Plus
CG5946-PA 313 CG5946-PA 1..313 4..316 1616 98.7 Plus
CG5946-PD 316 CG5946-PD 1..316 1..316 1513 90.5 Plus
CG5946-PG 330 CG5946-PG 1..330 1..316 1488 86.7 Plus