Clone MIP04348 Report

Search the DGRC for MIP04348

Clone and Library Details

Library:MIP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by:
Date Registered:2008-10-08
Comments:
Original Plate Number:43
Well:48
Vector:pOT2
Associated Gene/TranscriptCG12289-RA
Protein status:MIP04348.pep: gold
Sequenced Size:1348

Clone Sequence Records

MIP04348.complete Sequence

1348 bp assembled on 2009-04-28

GenBank Submission: BT082086.1

> MIP04348.complete
GAGTTATTCAAAATCAAAAAAACAAATTATGATCGATTTAAATTAAGGGC
AGAGAATCGAAGAAAGAAGTAGAGGAGGATCTGGATACGAAATCAGAGCT
TTAGACAATCGCCAGGATGACGCAATGGTGTGCTATCAGTGTAATGAAGG
CCGTGCTCTGCGTCGGCTGCACGGAGGTGGACTACGTGACCACCATGGAT
AAGGTCGACTTCCAGTGCGACAGGTGCAGCACCCAGAATGGAATGCTTCA
GCGCAGCGGAAGATCCTCGAATGTTAGTACGGCCCTGCGTCTGTTGGGCG
CCAATGTGGAGTTGTTCGGTGTGCTCACCCGTAATCCCACCTATCGCATG
ATTCTGGATGATCTCGAGCAGCGGGGCATTGATATTAGCCATTGTACATT
CACGGACGCAAGTCCTCCCTTTTCCACAATTGTCCAAGATCGCTGGACGC
GTCGTTGCACGGTGGTGTATTGCGACAAGTCATTTCCATATGTTACGGCA
GCGGATTTCCGCAAATTGGATCTCGATCAATACGGCTGGGTGAATTTTGA
GGCACGGAGTCCACGTGAAACTTGCGATATGATACGCCTAATCCTCGATC
ACAACAACGGGCGGGATGAACGGGATCGGATAGTGGTATCGTTGCAGATT
TTCAATTCCTTCGAACAGGTCGTGCATCTGATTGCCATGTGCGACTATGT
GTTCGTCACCAAGTATATAGCCGAGTCCAGAGGCTGGAAGTCACCGCTGG
AAGCCTGCGAGGGTGTCAATGCGCTACTGCGCATGCCAAGGAACATTAGA
ATTCGCAGACCCTGCATCATTGTGCCGTGGAGCAGCCTGGGAGCAGGATG
TATGACCACGGAAGGGGAGTACTTCGAAGTGCCAGCACACAAGCCGAAAA
AGATCATCGATCGGGTGGGCGATAGTGATTGCTTCACGGCGGGCTTCATT
TATGCCGCTTTTGTGCGGCAAAGGCGATTGGCCGAAGCCGTGGACTTCGC
CAATGCTGTGGCCAGCTATAAGTTGGGCTATGTGGGTTTCGATTGCCTGG
GTCATTTGCCAATCGATGCGGTTAAGCTGCCCGTTAGAATGAGGTGTGGC
AGTGAGGTGTCCTCCGACGATGAGGATAACGGCGATCAGTTGAATAGCTG
CAAGAAGCACCTGTTACGCCCGATTGAGTTCCTGCCGGAAAAGTCCTCCA
TTGCACCCACTGAGAAGGAAGTTCCGATCGAGACTTCGCAACTTTCTAGC
TAGAAAAGCACTGACCATCTGAAATATTCTGCAAATTTAAAACATTTAAT
GTATGGTTTATAAATCTAAGTGTATCACCTAAAAAAAAAAAAAAAAAA

MIP04348.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 16:22:35
Subject Length Description Subject Range Query Range Score Percent Strand
CG12289-RA 1395 CG12289-RA 63..1394 1..1332 6660 100 Plus
Blast to d_melanogaster_OreR.fa performed 2014-11-27 05:08:42
Subject Length Description Subject Range Query Range Score Percent Strand
chr3L 24539361 chr3L 11447856..11449185 1330..1 6620 99.8 Minus
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 05:08:39
Subject Length Description Subject Range Query Range Score Percent Strand
CG12289-RA 1137 CG12289-PA 1..1137 117..1253 5685 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 20:03:15 has no hits.
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 05:08:38
Subject Length Description Subject Range Query Range Score Percent Strand
CG12289-RA 1395 CG12289-RA 63..1392 1..1330 6650 100 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 05:08:41
Subject Length Description Subject Range Query Range Score Percent Strand
CG12289-PA 378 CG12289-PA 1..378 117..1250 1903 100 Plus
CG7328-PA 306 CG7328-PA 4..304 144..1064 610 42 Plus
CG7551-PB 322 CG7551-PB 15..316 147..1058 528 36.2 Plus
CG7335-PA 372 CG7335-PA 33..219 153..713 231 30.9 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 05:08:36
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 11457073..11458408 1336..1 6665 99.9 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 18:09:06
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28103327 3L 11450173..11451508 1336..1 6665 99.9 Minus
Blast to na_te.dros performed on 2014-11-27 05:08:37 has no hits.

MIP04348.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2014-11-27 06:26:42 Download gff for MIP04348.complete
Subject Subject Range Query Range Percent Splice Strand
chr3L 11447856..11449185 1..1330 99   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2009-10-19 17:51:13 Download gff for MIP04348.complete
Subject Subject Range Query Range Percent Splice Strand
CG12289-RA 1..1137 117..1253 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 13:46:28 Download gff for MIP04348.complete
Subject Subject Range Query Range Percent Splice Strand
CG12289-RA 1..1137 117..1253 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 09:53:04 Download gff for MIP04348.complete
Subject Subject Range Query Range Percent Splice Strand
CG12289-RA 1..1137 117..1253 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 06:26:42 Download gff for MIP04348.complete
Subject Subject Range Query Range Percent Splice Strand
CG12289-RA 1..1137 117..1253 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2009-04-28 17:10:13 Download gff for MIP04348.complete
Subject Subject Range Query Range Percent Splice Strand
CG12289-RA 63..1390 1..1328 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 13:46:27 Download gff for MIP04348.complete
Subject Subject Range Query Range Percent Splice Strand
CG12289-RA 63..1392 1..1330 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 09:53:04 Download gff for MIP04348.complete
Subject Subject Range Query Range Percent Splice Strand
CG12289-RA 63..1392 1..1330 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 06:26:42 Download gff for MIP04348.complete
Subject Subject Range Query Range Percent Splice Strand
CG12289-RA 63..1392 1..1330 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 06:26:42 Download gff for MIP04348.complete
Subject Subject Range Query Range Percent Splice Strand
3L 11457079..11458408 1..1330 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 09:53:04 Download gff for MIP04348.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 11450179..11451508 1..1330 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 11:32:17 Download gff for MIP04348.complete
Subject Subject Range Query Range Percent Splice Strand
3L 11450179..11451508 1..1330 100   Minus

MIP04348.pep Sequence

Translation from 116 to 1252

> MIP04348.pep
MTQWCAISVMKAVLCVGCTEVDYVTTMDKVDFQCDRCSTQNGMLQRSGRS
SNVSTALRLLGANVELFGVLTRNPTYRMILDDLEQRGIDISHCTFTDASP
PFSTIVQDRWTRRCTVVYCDKSFPYVTAADFRKLDLDQYGWVNFEARSPR
ETCDMIRLILDHNNGRDERDRIVVSLQIFNSFEQVVHLIAMCDYVFVTKY
IAESRGWKSPLEACEGVNALLRMPRNIRIRRPCIIVPWSSLGAGCMTTEG
EYFEVPAHKPKKIIDRVGDSDCFTAGFIYAAFVRQRRLAEAVDFANAVAS
YKLGYVGFDCLGHLPIDAVKLPVRMRCGSEVSSDDEDNGDQLNSCKKHLL
RPIEFLPEKSSIAPTEKEVPIETSQLSS*

MIP04348.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2014-11-28 06:49:37
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF24552-PA 375 GF24552-PA 1..366 1..365 1184 58.3 Plus
Dana\GF24486-PA 305 GF24486-PA 1..297 7..309 640 42.6 Plus
Dana\GF25264-PA 327 GF25264-PA 18..326 11..319 598 37.4 Plus
Dana\GF24487-PA 373 GF24487-PA 34..369 3..320 294 26.1 Plus
Blast to dere-all-translation-r1.3.fasta performed 2014-11-28 06:49:38
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG13921-PA 381 GG13921-PA 1..373 1..373 1857 90.9 Plus
Dere\GG13341-PA 306 GG13341-PA 1..304 7..316 627 41.3 Plus
Dere\GG15503-PA 322 GG15503-PA 15..316 11..314 574 36.5 Plus
Dere\GG13342-PA 375 GG13342-PA 34..370 11..319 316 26 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2014-11-28 06:49:40
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH15118-PA 307 GH15118-PA 1..301 10..317 662 41.4 Plus
Dgri\GH16650-PA 379 GH16650-PA 1..355 1..354 629 37.5 Plus
Dgri\GH14844-PA 322 GH14844-PA 15..316 11..314 566 37.5 Plus
Dgri\GH15119-PA 374 GH15119-PA 33..369 13..319 322 27.2 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 06:49:36
Subject Length Description Subject Range Query Range Score Percent Strand
CG12289-PA 378 CG12289-PA 1..378 1..378 2005 100 Plus
CG7328-PA 306 CG7328-PA 4..304 10..316 633 42 Plus
CG7551-PB 322 CG7551-PB 15..316 11..314 572 36.2 Plus
CG7335-PA 372 CG7335-PA 33..367 13..319 321 27.1 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2014-11-28 06:49:41
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI13769-PA 310 GI13769-PA 1..304 7..317 667 42.9 Plus
Dmoj\GI11611-PA 424 GI11611-PA 3..387 5..378 661 37.1 Plus
Dmoj\GI13697-PA 379 GI13697-PA 6..347 6..352 651 39.9 Plus
Dmoj\GI13699-PA 322 GI13699-PA 15..316 11..314 530 36.2 Plus
Dmoj\GI13771-PA 371 GI13771-PA 59..366 39..319 339 27.5 Plus
Blast to dper-all-translation-r1.3.fasta performed 2014-11-28 06:49:43
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL25057-PA 310 GL25057-PA 5..307 8..314 703 45 Plus
Dper\GL22827-PA 192 GL22827-PA 1..191 1..191 586 59.2 Plus
Dper\GL22794-PA 302 GL22794-PA 18..301 34..319 512 36.6 Plus
Dper\GL22825-PA 219 GL22825-PA 1..137 1..137 426 60.6 Plus
Dper\GL25058-PA 371 GL25058-PA 31..366 11..319 322 27.9 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2014-11-28 06:49:45
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA23880-PA 394 GA23880-PA 1..363 1..362 1006 55.6 Plus
Dpse\GA20264-PA 310 GA20264-PA 5..307 8..314 699 44.7 Plus
Dpse\GA20433-PA 327 GA20433-PA 16..326 11..319 542 36 Plus
Dpse\GA20271-PA 371 GA20271-PA 31..366 11..319 324 27.6 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2014-11-28 06:49:46
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM24754-PA 378 GM24754-PA 1..378 1..378 1984 97.6 Plus
Dsec\GM22247-PA 306 GM22247-PA 1..304 7..316 630 41 Plus
Dsec\GM25272-PA 322 GM25272-PA 15..316 11..314 589 36.5 Plus
Dsec\GM22248-PA 372 GM22248-PA 31..367 11..319 324 26.6 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2014-11-28 06:49:47
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD12805-PA 378 GD12805-PA 1..378 1..378 1984 97.4 Plus
Dsim\GD12218-PA 306 GD12218-PA 1..304 7..316 634 41.3 Plus
Dsim\GD14306-PA 322 GD14306-PA 15..316 11..314 589 36.5 Plus
Dsim\GD12219-PA 183 GD12219-PA 31..170 11..149 190 31.4 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2014-11-28 06:49:48
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ11289-PA 420 GJ11289-PA 1..350 1..354 699 41.7 Plus
Dvir\GJ13759-PA 310 GJ13759-PA 1..301 7..314 682 43 Plus
Dvir\GJ14039-PA 322 GJ14039-PA 15..311 11..309 577 36.8 Plus
Dvir\GJ13760-PA 370 GJ13760-PA 33..365 13..319 353 27.4 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2014-11-28 06:49:50
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK17169-PA 418 GK17169-PA 1..384 1..377 799 41.3 Plus
Dwil\GK17250-PA 308 GK17250-PA 1..305 7..314 680 42.9 Plus
Dwil\GK19276-PA 327 GK19276-PA 15..326 11..319 593 35.9 Plus
Dwil\GK17251-PA 698 GK17251-PA 31..367 11..311 290 26.8 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2014-11-28 06:49:51
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE20217-PA 380 GE20217-PA 1..373 1..374 1871 91.7 Plus
Dyak\GE22430-PA 306 GE22430-PA 1..302 7..314 632 41.9 Plus
Dyak\GE21811-PA 322 GE21811-PA 15..316 11..314 579 36.8 Plus
Dyak\GE22431-PA 375 GE22431-PA 34..370 11..319 330 26.9 Plus
Dyak\GE23230-PA 330 GE23230-PA 17..325 39..319 311 27.1 Plus

MIP04348.hyp Sequence

Translation from 116 to 1252

> MIP04348.hyp
MTQWCAISVMKAVLCVGCTEVDYVTTMDKVDFQCDRCSTQNGMLQRSGRS
SNVSTALRLLGANVELFGVLTRNPTYRMILDDLEQRGIDISHCTFTDASP
PFSTIVQDRWTRRCTVVYCDKSFPYVTAADFRKLDLDQYGWVNFEARSPR
ETCDMIRLILDHNNGRDERDRIVVSLQIFNSFEQVVHLIAMCDYVFVTKY
IAESRGWKSPLEACEGVNALLRMPRNIRIRRPCIIVPWSSLGAGCMTTEG
EYFEVPAHKPKKIIDRVGDSDCFTAGFIYAAFVRQRRLAEAVDFANAVAS
YKLGYVGFDCLGHLPIDAVKLPVRMRCGSEVSSDDEDNGDQLNSCKKHLL
RPIEFLPEKSSIAPTEKEVPIETSQLSS*

MIP04348.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:18:19
Subject Length Description Subject Range Query Range Score Percent Strand
CG12289-PA 378 CG12289-PA 1..378 1..378 2005 100 Plus
CG7328-PA 306 CG7328-PA 4..304 10..316 633 42 Plus
CG7551-PB 322 CG7551-PB 15..316 11..314 572 36.2 Plus
CG7335-PA 372 CG7335-PA 33..367 13..319 321 27.1 Plus