Clone MIP04417 Report

Search the DGRC for MIP04417

Clone and Library Details

Library:MIP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by:
Date Registered:2008-10-08
Comments:
Original Plate Number:44
Well:17
Vector:pOT2
Associated Gene/TranscriptCG10597-RB
Protein status:MIP04417.pep: gold
Sequenced Size:728

Clone Sequence Records

MIP04417.complete Sequence

728 bp assembled on 2009-02-05

GenBank Submission: BT058078.1

> MIP04417.complete
CTCAGCTTCGATCAGAATCTTAAATCTAATAAACTCAATTTCCAGAATGA
AGGTCTTTGTGTGCTTGTTGGCTTCCCTGGCTCTGGCCAACGCCGGTGGC
CTCCGAGGCGGTGCAGGAGGCGGCTATCTGCCCGGCGGAGGACGTGGTGG
TGGCGGCGGAGGATTCGGTGGCCGCCCGGCTATTGGAGCTGGCCTGGTGT
CCCACGTCTCGCAGTCGCAGGGCAACACTAAGGTCCACATTGGTGGTGGT
TCCGCCGGCGGTGCTGGTGCTTATGGCGGCGGTGCTGCCTCGTACGGCGG
TGGAGCTGGTGCTGCCTATGGAGGTGGTGCTGGAGCTTCCTACGGCGGTG
GTGCAGCCTCTTATGGCGGTGGACGCGGATCTGGTGGATGGCAAGGAGCT
GGAGCTGGAGCTGGTCGTGGTGGTGCTGGAGGAGCTGGTGGCTGGCAAGG
TGCTGGAGCAGGTCGTGGTGGAGCAGGAGGCTGGCAGGGTGGTGCCGGAG
GTGCTGGAGCTGGCAACGCCTGGGGTAACCCCGCTGAGTTCGATTACACT
GTCAACCACGCTTCCGGAGGTGCTGGTGGTGCAGGTGGGGCCTACGGTGG
TGCTGCTGGTGGTGGCTCCCGCGGCGGTGCCGGCTGGTGGAACGATTAAG
TAACGACACCTGTTTTATCTGTAAACGAATCTGAATCCGACCAATAAAGT
TTTAACATAAAAAAAAAAAAAAAAAAAA

MIP04417.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 21:22:43
Subject Length Description Subject Range Query Range Score Percent Strand
CG10597-RB 762 CG10597-RB 31..743 1..713 3565 100 Plus
CG10597-RA 1260 CG10597-RA 661..1260 50..649 3000 100 Plus
CG10597-RA 1260 CG10597-RA 550..603 1..54 270 100 Plus
Blast to d_melanogaster_OreR.fa performed 2014-11-27 04:58:06
Subject Length Description Subject Range Query Range Score Percent Strand
chrX 22417052 chrX 17119724..17120388 708..50 3155 98.6 Minus
chrX 22417052 chrX 17120446..17120499 54..1 270 100 Minus
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 04:58:04
Subject Length Description Subject Range Query Range Score Percent Strand
CG10597-RB 603 CG10597-PB 1..603 47..649 3015 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 20:03:19 has no hits.
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 04:58:03
Subject Length Description Subject Range Query Range Score Percent Strand
CG10597-RB 708 CG10597-RB 1..708 1..708 3540 100 Plus
Blast to dmel-all-translation-r6.02.fasta performed on 2014-11-27 04:58:05 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 04:58:02
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 17230270..17230933 713..50 3320 100 Minus
X 23542271 X 17230991..17231044 54..1 270 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:39:48
Subject Length Description Subject Range Query Range Score Percent Strand
X 23527363 X 17238368..17239031 713..50 3320 100 Minus
X 23527363 X 17239089..17239142 54..1 270 100 Minus
Blast to na_te.dros performed on 2014-11-27 04:58:03 has no hits.

MIP04417.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2014-11-27 06:23:09 Download gff for MIP04417.complete
Subject Subject Range Query Range Percent Splice Strand
chrX 17120448..17120499 1..52 100   Minus
chrX 17120182..17120385 53..256 99 <- Minus
chrX 17119724..17119990 442..708 99 == Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2009-10-19 18:05:11 Download gff for MIP04417.complete
Subject Subject Range Query Range Percent Splice Strand
CG10597-RB 1..603 47..649 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 21:34:03 Download gff for MIP04417.complete
Subject Subject Range Query Range Percent Splice Strand
CG10597-RB 1..603 47..649 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 09:52:12 Download gff for MIP04417.complete
Subject Subject Range Query Range Percent Splice Strand
CG10597-RB 1..603 47..649 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 06:23:09 Download gff for MIP04417.complete
Subject Subject Range Query Range Percent Splice Strand
CG10597-RB 1..603 47..649 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2009-02-05 16:31:09 Download gff for MIP04417.complete
Subject Subject Range Query Range Percent Splice Strand
CG10597-RB 1..603 47..649 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 21:34:02 Download gff for MIP04417.complete
Subject Subject Range Query Range Percent Splice Strand
CG10597-RB 1..603 47..649 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 09:52:12 Download gff for MIP04417.complete
Subject Subject Range Query Range Percent Splice Strand
CG10597-RB 1..708 1..708 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 06:23:09 Download gff for MIP04417.complete
Subject Subject Range Query Range Percent Splice Strand
CG10597-RB 1..708 1..708 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 06:23:09 Download gff for MIP04417.complete
Subject Subject Range Query Range Percent Splice Strand
X 17230993..17231044 1..52 100   Minus
X 17230275..17230930 53..708 100 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 09:52:12 Download gff for MIP04417.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 17125026..17125077 1..52 100   Minus
arm_X 17124308..17124963 53..708 100 <- Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 19:07:21 Download gff for MIP04417.complete
Subject Subject Range Query Range Percent Splice Strand
X 17239091..17239142 1..52 100   Minus
X 17238373..17239028 53..708 100 <- Minus

MIP04417.hyp Sequence

Translation from 0 to 648

> MIP04417.hyp
SASIRILNLINSISRMKVFVCLLASLALANAGGLRGGAGGGYLPGGGRGG
GGGGFGGRPAIGAGLVSHVSQSQGNTKVHIGGGSAGGAGAYGGGAASYGG
GAGAAYGGGAGASYGGGAASYGGGRGSGGWQGAGAGAGRGGAGGAGGWQG
AGAGRGGAGGWQGGAGGAGAGNAWGNPAEFDYTVNHASGGAGGAGGAYGG
AAGGGSRGGAGWWND*

MIP04417.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:39:57
Subject Length Description Subject Range Query Range Score Percent Strand
CG10597-PB 200 CG10597-PB 1..200 16..215 1102 100 Plus
Cpr47Ef-PD 601 CG13214-PD 272..460 29..210 349 47.3 Plus
Cpr47Ef-PC 612 CG13214-PC 272..460 29..210 349 47.3 Plus
CG17108-PA 342 CG17108-PA 83..296 32..212 345 39.8 Plus
Cpr47Ef-PD 601 CG13214-PD 230..406 26..212 343 41.8 Plus
Cpr47Ef-PD 601 CG13214-PD 252..426 32..211 343 44 Plus
Cpr47Ef-PC 612 CG13214-PC 230..406 26..212 343 41.8 Plus
Cpr47Ef-PC 612 CG13214-PC 252..426 32..211 343 44 Plus
Cpr47Ef-PC 612 CG13214-PC 342..535 33..212 338 45.2 Plus
Cpr47Ef-PD 601 CG13214-PD 342..524 33..212 334 44.6 Plus
Cpr47Ef-PC 612 CG13214-PC 318..490 32..210 324 44.6 Plus
Cpr47Ef-PC 612 CG13214-PC 353..521 32..211 323 45 Plus
Cpr47Ef-PD 601 CG13214-PD 353..542 32..211 322 44.4 Plus
CG17108-PA 342 CG17108-PA 1..233 16..211 320 37.3 Plus
CG5172-PD 172 CG5172-PD 8..172 18..213 320 42.1 Plus
Cpr47Ef-PD 601 CG13214-PD 374..562 32..211 319 43.8 Plus
Cpr47Ef-PC 612 CG13214-PC 374..540 32..211 316 44.2 Plus
Cpr47Ef-PD 601 CG13214-PD 318..510 32..211 312 43.8 Plus
CG17108-PA 342 CG17108-PA 136..326 31..210 311 41.4 Plus
Cpr47Ef-PC 612 CG13214-PC 388..573 32..211 308 43.3 Plus
CG17108-PA 342 CG17108-PA 164..330 37..210 306 41.1 Plus
Cpr47Ef-PD 601 CG13214-PD 407..575 33..207 299 47.5 Plus
Cpr47Ef-PC 612 CG13214-PC 407..586 33..207 294 44.8 Plus
Cpr47Ef-PD 601 CG13214-PD 433..589 31..211 252 38.7 Plus
Cpr47Ef-PC 612 CG13214-PC 439..600 32..211 244 39.5 Plus
CG17108-PA 342 CG17108-PA 197..342 25..199 238 35.7 Plus
CG17108-PA 342 CG17108-PA 20..140 81..214 203 39.7 Plus
Cpr47Ef-PD 601 CG13214-PD 440..595 32..177 203 40.3 Plus
Cpr47Ef-PD 601 CG13214-PD 30..115 102..197 185 47.9 Plus
Cpr47Ef-PC 612 CG13214-PC 30..115 102..197 185 47.9 Plus
Cpr47Ef-PD 601 CG13214-PD 39..113 81..160 172 46.2 Plus
Cpr47Ef-PC 612 CG13214-PC 39..113 81..160 172 46.2 Plus
Cpr47Ef-PD 601 CG13214-PD 94..292 33..211 169 29.8 Plus
Cpr47Ef-PC 612 CG13214-PC 94..292 33..211 169 29.8 Plus
Cpr47Ef-PD 601 CG13214-PD 32..114 38..147 166 41.8 Plus
Cpr47Ef-PC 612 CG13214-PC 32..114 38..147 166 41.8 Plus
Cpr47Ef-PD 601 CG13214-PD 31..115 84..173 162 42.1 Plus
Cpr47Ef-PD 601 CG13214-PD 35..117 83..170 162 48.3 Plus
Cpr47Ef-PC 612 CG13214-PC 31..115 84..173 162 42.1 Plus
Cpr47Ef-PC 612 CG13214-PC 35..117 83..170 162 48.3 Plus
Cpr47Ef-PD 601 CG13214-PD 32..131 29..147 147 39.5 Plus
Cpr47Ef-PC 612 CG13214-PC 32..131 29..147 147 39.5 Plus

MIP04417.pep Sequence

Translation from 1 to 648

> MIP04417.pep
SASIRILNLINSISRMKVFVCLLASLALANAGGLRGGAGGGYLPGGGRGG
GGGGFGGRPAIGAGLVSHVSQSQGNTKVHIGGGSAGGAGAYGGGAASYGG
GAGAAYGGGAGASYGGGAASYGGGRGSGGWQGAGAGAGRGGAGGAGGWQG
AGAGRGGAGGWQGGAGGAGAGNAWGNPAEFDYTVNHASGGAGGAGGAYGG
AAGGGSRGGAGWWND*

MIP04417.pep Blast Records

Blast to dere-all-translation-r1.3.fasta performed 2014-11-28 09:27:31
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG18194-PA 211 GG18194-PA 1..65 16..80 152 90.8 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 09:27:23
Subject Length Description Subject Range Query Range Score Percent Strand
CG10597-PB 200 CG10597-PB 1..200 16..215 1102 100 Plus
Cpr47Ef-PD 601 CG13214-PD 272..460 29..210 349 47.3 Plus
Cpr47Ef-PC 612 CG13214-PC 272..460 29..210 349 47.3 Plus
CG17108-PA 342 CG17108-PA 83..296 32..212 345 39.8 Plus
Cpr47Ef-PD 601 CG13214-PD 230..406 26..212 343 41.8 Plus
Cpr47Ef-PD 601 CG13214-PD 252..426 32..211 343 44 Plus
Cpr47Ef-PC 612 CG13214-PC 230..406 26..212 343 41.8 Plus
Cpr47Ef-PC 612 CG13214-PC 252..426 32..211 343 44 Plus
Cpr47Ef-PC 612 CG13214-PC 342..535 33..212 338 45.2 Plus
Cpr47Ef-PD 601 CG13214-PD 342..524 33..212 334 44.6 Plus
Cpr47Ef-PC 612 CG13214-PC 318..490 32..210 324 44.6 Plus
Cpr47Ef-PC 612 CG13214-PC 353..521 32..211 323 45 Plus
Cpr47Ef-PD 601 CG13214-PD 353..542 32..211 322 44.4 Plus
CG17108-PA 342 CG17108-PA 1..233 16..211 320 37.3 Plus
CG5172-PD 172 CG5172-PD 8..172 18..213 320 42.1 Plus
Cpr47Ef-PD 601 CG13214-PD 374..562 32..211 319 43.8 Plus
Cpr47Ef-PC 612 CG13214-PC 374..540 32..211 316 44.2 Plus
Cpr47Ef-PD 601 CG13214-PD 318..510 32..211 312 43.8 Plus
CG17108-PA 342 CG17108-PA 136..326 31..210 311 41.4 Plus
Cpr47Ef-PC 612 CG13214-PC 388..573 32..211 308 43.3 Plus
CG17108-PA 342 CG17108-PA 164..330 37..210 306 41.1 Plus
Cpr47Ef-PD 601 CG13214-PD 407..575 33..207 299 47.5 Plus
Cpr47Ef-PC 612 CG13214-PC 407..586 33..207 294 44.8 Plus
Cpr47Ef-PD 601 CG13214-PD 433..589 31..211 252 38.7 Plus
Cpr47Ef-PC 612 CG13214-PC 439..600 32..211 244 39.5 Plus
CG17108-PA 342 CG17108-PA 197..342 25..199 238 35.7 Plus
CG17108-PA 342 CG17108-PA 20..140 81..214 203 39.7 Plus
Cpr47Ef-PD 601 CG13214-PD 440..595 32..177 203 40.3 Plus
Cpr47Ef-PD 601 CG13214-PD 30..115 102..197 185 47.9 Plus
Cpr47Ef-PC 612 CG13214-PC 30..115 102..197 185 47.9 Plus
Cpr47Ef-PD 601 CG13214-PD 39..113 81..160 172 46.2 Plus
Cpr47Ef-PC 612 CG13214-PC 39..113 81..160 172 46.2 Plus
Cpr47Ef-PD 601 CG13214-PD 94..292 33..211 169 29.8 Plus
Cpr47Ef-PC 612 CG13214-PC 94..292 33..211 169 29.8 Plus
Cpr47Ef-PD 601 CG13214-PD 32..114 38..147 166 41.8 Plus
Cpr47Ef-PC 612 CG13214-PC 32..114 38..147 166 41.8 Plus
Cpr47Ef-PD 601 CG13214-PD 31..115 84..173 162 42.1 Plus
Cpr47Ef-PD 601 CG13214-PD 35..117 83..170 162 48.3 Plus
Cpr47Ef-PC 612 CG13214-PC 31..115 84..173 162 42.1 Plus
Cpr47Ef-PC 612 CG13214-PC 35..117 83..170 162 48.3 Plus
Cpr47Ef-PD 601 CG13214-PD 32..131 29..147 147 39.5 Plus
Cpr47Ef-PC 612 CG13214-PC 32..131 29..147 147 39.5 Plus