Clone MIP04453 Report

Search the DGRC for MIP04453

Clone and Library Details

Library:MIP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by:
Date Registered:2008-10-08
Comments:
Original Plate Number:44
Well:53
Vector:pOT2
Associated Gene/TranscriptCG9825-RA
Protein status:MIP04453.pep: gold
Sequenced Size:1524

Clone Sequence Records

MIP04453.complete Sequence

1524 bp assembled on 2009-04-07

GenBank Submission: BT081994.1

> MIP04453.complete
TCGTTTAAAAGAAGTCAGGAGGTGTTTTGTTGACCAAATCAAAAATGACG
GCCGAGACAAACAAAGGACCCGTTCTGGGAATGAGGCATGTCCAGGCGCT
ACTGATCTTCCTCAATATAACTACCGTATTCATAGGCCGCCTAAATGTGG
GCGTGTCTGTGGTGGCAATGACCAATGCGGAAACCACGAACCCGAACTTT
CCGGAATACGATTGGACGGAGGCAGAGAAGTCGTACATTCTCTCCAGTTT
CTTTTGGGGCTACATCCTAACGCAATTCCTTGGAGGTTATCTCTGCAAGC
GCTTTGGAGTCAAGAGTGTAATGTTTTGGGGTGTCTTCGGATCTGGTGTC
TGCAGTGCTTTGACGCCGCTGTTCATCGGATTTGGAGAATGGCAGGCCTA
CTGTGGAATTCGAGTTCTAATGGGATTGGCCCAGGGAGTGGTATTCCCCT
GCATTCATCAGCACCTGGCTAAATGGTCACCGCCCGAGGAAAGAAATCGG
TTGGGAGCTCTGAGTCACACTGGAATCGAGTGCGGCAATGTGAGTGCCAT
GTTCCTGAGCGGAATGATAGCCAAGAGCTCCCTGGGATGGCCCGGAATCT
CATATGTCTCGGCTGGAGTGGCCTTCTTCTGGTGTACATTATGGTTCGTC
TTCGCTGCCAACCATCCTACGGAATCTCGTTTCATAGGAGAGAACGAACT
GATCTATATTGAGTCGTCTCTAAAGCACAATGAGTCATACCACGCTACCA
TTATACCCATTCCCTGGAAGGCAATTTGGACGTCGGCACCATTCCTGGCC
CTGCTCATAGTACGATGCGCTGAGAACTGGGGACTGAGCACTCTGCAGGC
CGAGATCCCATCCTATATGAACGGAGTCCTCGACATGGACATGAAGAGCA
ATGCGTTCTTCTCGGCACTCCCATTCTTGGCCATGTGGTGCATGTCGTAT
ATTTACCTAGTCGTAGCCGATGTGCTCTTGGGCAAGAACTCGGTGTCCTT
GACGATTTTGAGAAAGACCTACAACTCCATTGCCTTCTGGATTCCTGCTG
CCACTTTGGTGGGCATTGGCTTTTTGGACAAGGAACAAAAGAACTTCGCG
ATTGCTCTGATGACCATCAGTGTGGGCGTGAATAGTGCTCAAACCATTGG
CAGTGTTTTAAACACAATTGATCTATCGAAAAATCACGCTAGCATTCTAA
TGGGAATTGTGAATACAGCGGCGAATTTCGTGCCCATAGTCACTCCTTTA
GTTGTTGGATGGATTGTTAAGGAAAATTCTGATCGCTCCCAATGGCAGAT
CGTGTTCATCATTGCCTCCGTAATCTTCTTTGTGGGCAATTGCATTTACT
TGGTGTTTGGCACGGCCGAAACTCAGCCCTGGGATGCCGAGGACTATCTG
CAGACACAGAACCCGGAACTTGCCAATAGACCACCTATGCAGGCGTTATC
CTTTCCAATTAACGAAAATTCCAAAGAGAAAATTAATAGTAAAAGCCATT
AATTCTTAAAAAAAAAAAAAAAAA

MIP04453.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 21:29:34
Subject Length Description Subject Range Query Range Score Percent Strand
CG9825-RA 1568 CG9825-RA 30..1538 1..1509 7545 100 Plus
CG12490.a 1498 CG12490.a 15..807 1..793 2375 86.6 Plus
CG12490-RA 1422 CG12490-RA 3..731 65..793 2130 86.1 Plus
CG12490.a 1498 CG12490.a 841..972 827..958 330 83.3 Plus
CG12490-RA 1422 CG12490-RA 765..896 827..958 330 83.3 Plus
CG12490.a 1498 CG12490.a 1028..1151 1014..1137 245 79.8 Plus
CG12490-RA 1422 CG12490-RA 952..1075 1014..1137 245 79.8 Plus
CG12490.a 1498 CG12490.a 1175..1273 1161..1259 150 76.7 Plus
CG12490-RA 1422 CG12490-RA 1099..1197 1161..1259 150 76.7 Plus
Blast to d_melanogaster_OreR.fa performed 2014-11-27 12:14:59
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 18724486..18725560 203..1277 5375 100 Plus
chr2R 21145070 chr2R 18721761..18722817 203..1259 1820 78.1 Plus
chr2R 21145070 chr2R 18719695..18720751 203..1259 1580 76.6 Plus
chr2R 21145070 chr2R 18725628..18725857 1278..1507 1135 99.6 Plus
chr2R 21145070 chr2R 18724291..18724430 65..204 700 100 Plus
chr2R 21145070 chr2R 18721566..18721705 65..204 685 99.3 Plus
chr2R 21145070 chr2R 18728181..18728366 753..938 330 78.5 Plus
chr2R 21145070 chr2R 18723963..18724029 1..67 320 98.5 Plus
chr2R 21145070 chr2R 18721232..18721298 1..67 245 91 Plus
chr2R 21145070 chr2R 1849460..1849573 974..861 195 78.1 Minus
chr2R 21145070 chr2R 18727637..18727711 209..283 195 84 Plus
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 12:14:56
Subject Length Description Subject Range Query Range Score Percent Strand
CG9825-RA 1458 CG9825-PA 1..1458 45..1502 7290 100 Plus
CG12490-RB 1440 CG12490-PB 1..1271 45..1315 2650 80.6 Plus
CG30265-RB 1458 CG30265-PB 1..1352 45..1396 1660 74.9 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 20:03:25 has no hits.
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 12:14:54
Subject Length Description Subject Range Query Range Score Percent Strand
CG9825-RA 1543 CG9825-RA 32..1538 1..1507 7535 100 Plus
CG12490-RB 1647 CG12490-RB 10..1324 1..1315 2795 80.8 Plus
CG30265-RB 1622 CG30265-RB 58..1409 45..1396 1660 74.9 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 12:14:58
Subject Length Description Subject Range Query Range Score Percent Strand
CG9825-PA 485 CG9825-PA 1..485 45..1499 2491 100 Plus
CG12490-PB 479 CG12490-PB 1..463 45..1433 2003 82.5 Plus
CG30265-PB 485 CG30265-PB 1..485 45..1499 1932 75.5 Plus
CG30265-PA 485 CG30265-PA 1..485 45..1499 1932 75.5 Plus
CG9826-PC 495 CG9826-PC 1..464 45..1436 1582 63.1 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 12:14:52
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 22837915..22838989 203..1277 5375 100 Plus
2R 25286936 2R 22835185..22836241 203..1259 1850 78.3 Plus
2R 25286936 2R 22833119..22834175 203..1259 1595 76.7 Plus
2R 25286936 2R 22839057..22839288 1278..1509 1160 100 Plus
2R 25286936 2R 22834990..22835129 65..204 700 100 Plus
2R 25286936 2R 22837720..22837859 65..204 700 100 Plus
2R 25286936 2R 22837392..22837458 1..67 335 100 Plus
2R 25286936 2R 22841605..22841790 753..938 315 78 Plus
2R 25286936 2R 22834656..22834722 1..67 260 92.5 Plus
2R 25286936 2R 5962261..5962374 974..861 195 78.1 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:46:12
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 22839114..22840188 203..1277 5375 100 Plus
2R 25260384 2R 22836384..22836974 203..793 1440 82.9 Plus
2R 25260384 2R 22840256..22840487 1278..1509 1160 100 Plus
2R 25260384 2R 22834318..22834905 203..790 1110 79.2 Plus
2R 25260384 2R 22838919..22839058 65..204 700 100 Plus
2R 25260384 2R 22836189..22836328 65..204 700 100 Plus
2R 25260384 2R 22838591..22838657 1..67 335 100 Plus
2R 25260384 2R 22837008..22837139 827..958 330 83.3 Plus
2R 25260384 2R 22834942..22835065 827..950 320 83.8 Plus
2R 25260384 2R 22835126..22835252 1011..1137 290 81.8 Plus
2R 25260384 2R 22842882..22842989 831..938 270 83.3 Plus
2R 25260384 2R 22835855..22835921 1..67 260 92.5 Plus
2R 25260384 2R 22837195..22837318 1014..1137 245 79.8 Plus
2R 25260384 2R 5963460..5963573 974..861 195 78 Minus
2R 25260384 2R 22842260..22842319 209..268 180 86.6 Plus
2R 25260384 2R 22837342..22837440 1161..1259 150 76.7 Plus
2R 25260384 2R 22832177..22832242 839..904 150 81.8 Plus
2R 25260384 2R 22832520..22832575 1182..1237 145 83.9 Plus
2R 25260384 2R 22831554..22831629 234..309 140 78.9 Plus
Blast to na_te.dros performed on 2014-11-27 12:14:53 has no hits.

MIP04453.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2014-11-27 13:42:33 Download gff for MIP04453.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 18725628..18725857 1278..1507 99   Plus
chr2R 18724487..18725560 204..1277 100 -> Plus
chr2R 18724293..18724429 67..203 100 -> Plus
chr2R 18723963..18724028 1..66 98 -> Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2009-10-19 18:08:55 Download gff for MIP04453.complete
Subject Subject Range Query Range Percent Splice Strand
CG9825-RA 1..1458 45..1502 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 21:44:16 Download gff for MIP04453.complete
Subject Subject Range Query Range Percent Splice Strand
CG9825-RA 1..1458 45..1502 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 17:49:28 Download gff for MIP04453.complete
Subject Subject Range Query Range Percent Splice Strand
CG9825-RA 1..1458 45..1502 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 13:42:33 Download gff for MIP04453.complete
Subject Subject Range Query Range Percent Splice Strand
CG9825-RA 1..1458 45..1502 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2009-04-07 16:11:53 Download gff for MIP04453.complete
Subject Subject Range Query Range Percent Splice Strand
CG9825-RA 30..1536 1..1507 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 21:44:16 Download gff for MIP04453.complete
Subject Subject Range Query Range Percent Splice Strand
CG9825-RA 30..1536 1..1507 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:49:28 Download gff for MIP04453.complete
Subject Subject Range Query Range Percent Splice Strand
CG9825-RA 32..1538 1..1507 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 13:42:33 Download gff for MIP04453.complete
Subject Subject Range Query Range Percent Splice Strand
CG9825-RA 32..1538 1..1507 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 13:42:33 Download gff for MIP04453.complete
Subject Subject Range Query Range Percent Splice Strand
2R 22839057..22839286 1278..1507 100   Plus
2R 22837916..22838989 204..1277 100 -> Plus
2R 22837722..22837858 67..203 100 -> Plus
2R 22837392..22837457 1..66 100 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:49:28 Download gff for MIP04453.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 18726580..18726809 1278..1507 100   Plus
arm_2R 18725439..18726512 204..1277 100 -> Plus
arm_2R 18725245..18725381 67..203 100 -> Plus
arm_2R 18724915..18724980 1..66 100 -> Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 19:19:22 Download gff for MIP04453.complete
Subject Subject Range Query Range Percent Splice Strand
2R 22840274..22840503 1278..1507 100   Plus
2R 22839133..22840206 204..1277 100 -> Plus
2R 22838939..22839075 67..203 100 -> Plus
2R 22838609..22838674 1..66 100 -> Plus

MIP04453.pep Sequence

Translation from 44 to 1501

> MIP04453.pep
MTAETNKGPVLGMRHVQALLIFLNITTVFIGRLNVGVSVVAMTNAETTNP
NFPEYDWTEAEKSYILSSFFWGYILTQFLGGYLCKRFGVKSVMFWGVFGS
GVCSALTPLFIGFGEWQAYCGIRVLMGLAQGVVFPCIHQHLAKWSPPEER
NRLGALSHTGIECGNVSAMFLSGMIAKSSLGWPGISYVSAGVAFFWCTLW
FVFAANHPTESRFIGENELIYIESSLKHNESYHATIIPIPWKAIWTSAPF
LALLIVRCAENWGLSTLQAEIPSYMNGVLDMDMKSNAFFSALPFLAMWCM
SYIYLVVADVLLGKNSVSLTILRKTYNSIAFWIPAATLVGIGFLDKEQKN
FAIALMTISVGVNSAQTIGSVLNTIDLSKNHASILMGIVNTAANFVPIVT
PLVVGWIVKENSDRSQWQIVFIIASVIFFVGNCIYLVFGTAETQPWDAED
YLQTQNPELANRPPMQALSFPINENSKEKINSKSH*

MIP04453.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2014-11-28 08:28:30
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF13545-PA 474 GF13545-PA 1..462 1..462 2097 84 Plus
Dana\GF13544-PA 483 GF13544-PA 1..479 1..479 2013 77.2 Plus
Dana\GF13546-PA 496 GF13546-PA 1..485 1..481 1600 60.8 Plus
Dana\GF13543-PA 498 GF13543-PA 1..489 1..479 1490 55.4 Plus
Dana\GF13830-PA 570 GF13830-PA 97..557 6..466 1441 55.5 Plus
Blast to dere-all-translation-r1.3.fasta performed 2014-11-28 08:28:31
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG22802-PA 473 GG22802-PA 1..463 1..463 2300 92.4 Plus
Dere\GG22801-PA 481 GG22801-PA 1..480 1..480 2007 79 Plus
Dere\GG22800-PA 469 GG22800-PA 1..458 1..458 1958 77.3 Plus
Dere\GG22805-PA 495 GG22805-PA 1..462 1..462 1613 63 Plus
Dere\GG22799-PA 509 GG22799-PA 1..489 1..479 1508 56.2 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2014-11-28 08:28:32
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH19792-PA 477 GH19792-PA 10..461 9..460 1851 75.2 Plus
Dgri\GH19791-PA 480 GH19791-PA 1..480 1..477 1577 59.9 Plus
Dgri\GH19793-PA 483 GH19793-PA 1..446 13..458 1544 64.1 Plus
Dgri\GH20411-PA 438 GH20411-PA 1..417 42..458 1413 59.2 Plus
Dgri\GH13783-PA 482 GH13783-PA 7..466 4..461 1376 58 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 08:28:27
Subject Length Description Subject Range Query Range Score Percent Strand
CG9825-PA 485 CG9825-PA 1..485 1..485 2557 100 Plus
CG12490-PB 479 CG12490-PB 1..463 1..463 2064 82.5 Plus
CG30265-PB 485 CG30265-PB 1..485 1..485 1994 75.5 Plus
CG30265-PA 485 CG30265-PA 1..485 1..485 1994 75.5 Plus
CG9826-PC 495 CG9826-PC 1..464 1..464 1635 63.1 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2014-11-28 08:28:34
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI20332-PA 477 GI20332-PA 1..473 1..483 1980 76 Plus
Dmoj\GI20333-PA 496 GI20333-PA 9..460 7..458 1585 64.6 Plus
Dmoj\GI20331-PA 481 GI20331-PA 1..469 10..484 1467 56.2 Plus
Dmoj\GI19599-PA 442 GI19599-PA 1..417 42..458 1367 56.4 Plus
Dmoj\GI24818-PA 484 GI24818-PA 7..463 4..461 1356 57 Plus
Blast to dper-all-translation-r1.3.fasta performed 2014-11-28 08:28:35
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL11387-PA 472 GL11387-PA 1..472 1..477 2024 77.8 Plus
Dper\GL11388-PA 494 GL11388-PA 1..458 1..458 1643 64 Plus
Dper\GL11386-PA 488 GL11386-PA 1..461 1..455 1521 59.7 Plus
Dper\GL17791-PA 483 GL17791-PA 13..478 9..467 1470 56.7 Plus
Dper\GL23448-PA 495 GL23448-PA 1..465 1..463 1311 55.3 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2014-11-28 08:28:37
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA15735-PA 472 GA15735-PA 1..472 1..477 2021 77.6 Plus
Dpse\GA22061-PA 494 GA22061-PA 1..458 1..458 1641 64 Plus
Dpse\GA15741-PA 487 GA15741-PA 1..461 1..455 1525 59.9 Plus
Dpse\GA24910-PA 481 GA24910-PA 4..460 2..458 1481 57.8 Plus
Dpse\GA27256-PA 497 GA27256-PA 1..448 1..447 1306 56.5 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2014-11-28 08:28:38
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM15959-PA 481 GM15959-PA 1..481 1..485 2441 94.6 Plus
Dsec\GM15958-PA 492 GM15958-PA 1..481 1..482 1994 76.1 Plus
Dsec\GM16495-PA 482 GM16495-PA 3..482 4..485 1485 54.8 Plus
Dsec\GM16458-PA 492 GM16458-PA 9..462 6..458 1259 53.4 Plus
Dsec\GM19872-PA 508 GM19872-PA 50..490 11..447 994 42.4 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2014-11-28 08:28:40
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD11713-PA 485 GD11713-PA 1..485 1..485 2501 96.7 Plus
Dsim\GD11711-PA 481 GD11711-PA 1..480 1..480 2009 76.5 Plus
Dsim\GD11714-PA 494 GD11714-PA 1..483 1..481 1587 60.1 Plus
Dsim\GD11710-PA 497 GD11710-PA 1..492 1..485 1551 57.5 Plus
Dsim\GD10346-PA 482 GD10346-PA 3..482 4..485 1491 55 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2014-11-28 08:28:41
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ22056-PA 477 GJ22056-PA 1..477 1..482 1951 75.3 Plus
Dvir\GJ22058-PA 496 GJ22058-PA 5..485 3..481 1637 62.2 Plus
Dvir\GJ22055-PA 492 GJ22055-PA 1..492 1..482 1531 57.4 Plus
Dvir\GJ18404-PA 481 GJ18404-PA 4..480 3..485 1488 55.7 Plus
Dvir\GJ24462-PA 477 GJ24462-PA 7..452 4..450 1343 58.6 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2014-11-28 08:28:42
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK21464-PA 482 GK21464-PA 1..462 1..462 1972 79 Plus
Dwil\GK21465-PA 503 GK21465-PA 1..482 1..466 1598 61.4 Plus
Dwil\GK21460-PA 494 GK21460-PA 1..482 1..478 1564 58.5 Plus
Dwil\GK21757-PA 911 GK21757-PA 430..903 8..485 1485 55.6 Plus
Dwil\GK21756-PA 490 GK21756-PA 3..477 2..479 1475 55.4 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2014-11-28 08:28:44
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE14237-PA 473 GE14237-PA 1..463 1..463 2345 94.4 Plus
Dyak\GE14236-PA 483 GE14236-PA 1..481 1..484 2078 79.5 Plus
Dyak\GE14235-PA 480 GE14235-PA 1..467 1..467 2001 77.7 Plus
Dyak\GE14238-PA 495 GE14238-PA 1..460 1..460 1617 63.5 Plus
Dyak\GE14234-PA 509 GE14234-PA 1..489 1..479 1552 57.7 Plus

MIP04453.hyp Sequence

Translation from 44 to 1501

> MIP04453.hyp
MTAETNKGPVLGMRHVQALLIFLNITTVFIGRLNVGVSVVAMTNAETTNP
NFPEYDWTEAEKSYILSSFFWGYILTQFLGGYLCKRFGVKSVMFWGVFGS
GVCSALTPLFIGFGEWQAYCGIRVLMGLAQGVVFPCIHQHLAKWSPPEER
NRLGALSHTGIECGNVSAMFLSGMIAKSSLGWPGISYVSAGVAFFWCTLW
FVFAANHPTESRFIGENELIYIESSLKHNESYHATIIPIPWKAIWTSAPF
LALLIVRCAENWGLSTLQAEIPSYMNGVLDMDMKSNAFFSALPFLAMWCM
SYIYLVVADVLLGKNSVSLTILRKTYNSIAFWIPAATLVGIGFLDKEQKN
FAIALMTISVGVNSAQTIGSVLNTIDLSKNHASILMGIVNTAANFVPIVT
PLVVGWIVKENSDRSQWQIVFIIASVIFFVGNCIYLVFGTAETQPWDAED
YLQTQNPELANRPPMQALSFPINENSKEKINSKSH*

MIP04453.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:55:02
Subject Length Description Subject Range Query Range Score Percent Strand
CG9825-PA 485 CG9825-PA 1..485 1..485 2557 100 Plus
CG12490-PB 479 CG12490-PB 1..463 1..463 2064 82.5 Plus
CG30265-PB 485 CG30265-PB 1..485 1..485 1994 75.5 Plus
CG30265-PA 485 CG30265-PA 1..485 1..485 1994 75.5 Plus
CG9826-PC 495 CG9826-PC 1..464 1..464 1635 63.1 Plus