Clone MIP04624 Report

Search the DGRC for MIP04624

Clone and Library Details

Library:MIP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by:
Date Registered:2008-10-08
Comments:
Original Plate Number:46
Well:24
Vector:pOT2
Associated Gene/TranscriptCG14907-RA
Protein status:MIP04624.pep: gold
Sequenced Size:1109

Clone Sequence Records

MIP04624.complete Sequence

1109 bp assembled on 2009-04-03

GenBank Submission: BT081391.1

> MIP04624.complete
TCAACCGCACCGCAATTTCATTTGGTTGGCCAATTGAATGATGTAAACAT
GTCTGCACATTACTGCGGCTACAACCCGCCGCCGCCGAACTTCAAAACCT
TTTTTCCCGAAAAATACAAGGACCGACTGCAGCGACTTCCCAATTTTGGA
AAATTGCGATCATCGTGGGAGATCCACAGGCGACCGACCCTCGTGGTTCT
TCATGTGTTTGCGGATGATATCGGTGCGCTAGACAAATGGATAGATGTGG
TATACCGACTAGCTGCCCCTGGGTTTCTTGGCGGCGAGATGGACTTTTTC
GTGGACGATCTGTGGCAGTCGTTCATCTTCAATGAGGATGACTTCAGCTT
CTCTCGGAGTGACGAAGGATGTACAGTGGACTCATTTCCCCTGATATACG
CCGCAAATTCAACTGGAAAGGTATTCTTCTTTGGGGATTTCACTGGGCCT
AAACTGCCCGACCTGGAGAGTCTAAGGGATTTCTGCGATCAGGTGATTAA
GGGGATAGCCGAGGAGCCCACTGCTAGAGATCCCAAGGTTGAGAATATAA
GCCTTGATAGCTGGAACGAACTTATGTACGCCAGTGATAATGATATAGCG
ATTTGCTTCTACAACTCCTTGCAAAATGGCGCTGAAGTCAATAGTAGTCT
TATGGCAAATCTGGATTGGCTGGCCGATAAACTGAAACAGGAGTCAGTGC
TTCTGTACAAGATGGATATACATGGATCTAGAATCCCAAAAAGTTCCTCG
TAGAGTCGCCACCCGACTTCTTCTTCCTCCAGGCAAACCAAAAGCATAAT
CCCTTGCGGTGCAAATATCAGCTGAACATGTGGACAATGCTGAGATTTGT
AGCCGAAAATTCTAGCAAGGAGCTTAGCTACTATAACCGTCGTGGAAATC
GAAAACTCCATGCTGATTTGTTAATCCATATAAAGGATTATTTTAATTTG
AGCAGGAATAAGACCCGTTATTAGTAGTGGGTATAACATTAAAACTTTGA
TATTTATCTTTATTTAACTGTGCATATAGACCTTTGTTTTTAATGACCTT
ACATCTTAGAGAATTGTAAAATTATAACTCAGTCGGTATTCAAAAAAAAA
AAAAAAAAA

MIP04624.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 21:28:36
Subject Length Description Subject Range Query Range Score Percent Strand
CG14906-RB 2327 CG14906-RB 1..1093 1..1093 5465 100 Plus
CG14907-RB 2327 CG14907-RB 1..1093 1..1093 5465 100 Plus
CG14907-RA 1091 CG14907-RA 1..1091 1..1091 5455 100 Plus
Blast to d_melanogaster_OreR.fa performed 2014-11-27 12:03:14
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 12475779..12476869 1091..1 5455 100 Minus
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 12:03:11
Subject Length Description Subject Range Query Range Score Percent Strand
CG14907-RA 705 CG14907-PA 1..705 49..753 3525 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 20:03:43 has no hits.
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 12:03:10
Subject Length Description Subject Range Query Range Score Percent Strand
CG14907-RA 1103 CG14907-RA 13..1103 1..1091 5455 100 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 12:03:13
Subject Length Description Subject Range Query Range Score Percent Strand
CG14907-PA 234 CG14907-PA 1..231 49..741 1159 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 12:03:08
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 16651215..16652307 1093..1 5465 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:45:19
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 16392046..16393138 1093..1 5465 100 Minus
Blast to na_te.dros performed on 2014-11-27 12:03:09 has no hits.

MIP04624.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2014-11-27 13:00:59 Download gff for MIP04624.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 12475779..12476869 1..1091 100   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2009-10-19 18:08:15 Download gff for MIP04624.complete
Subject Subject Range Query Range Percent Splice Strand
CG14907-RB 1..705 49..753 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 21:42:50 Download gff for MIP04624.complete
Subject Subject Range Query Range Percent Splice Strand
CG14907-RB 1..705 49..753 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 17:34:59 Download gff for MIP04624.complete
Subject Subject Range Query Range Percent Splice Strand
CG14907-RA 1..705 49..753 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 13:00:59 Download gff for MIP04624.complete
Subject Subject Range Query Range Percent Splice Strand
CG14907-RA 1..705 49..753 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2009-04-03 09:27:30 Download gff for MIP04624.complete
Subject Subject Range Query Range Percent Splice Strand
CG14907-RB 1..1059 33..1091 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 21:42:50 Download gff for MIP04624.complete
Subject Subject Range Query Range Percent Splice Strand
CG14906-RB 1..1091 1..1091 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:34:59 Download gff for MIP04624.complete
Subject Subject Range Query Range Percent Splice Strand
CG14907-RA 13..1103 1..1091 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 13:00:59 Download gff for MIP04624.complete
Subject Subject Range Query Range Percent Splice Strand
CG14907-RA 13..1103 1..1091 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 13:00:59 Download gff for MIP04624.complete
Subject Subject Range Query Range Percent Splice Strand
3R 16651217..16652307 1..1091 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:34:59 Download gff for MIP04624.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 12476939..12478029 1..1091 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 19:17:43 Download gff for MIP04624.complete
Subject Subject Range Query Range Percent Splice Strand
3R 16392048..16393138 1..1091 100   Minus

MIP04624.pep Sequence

Translation from 0 to 752

> MIP04624.pep
STAPQFHLVGQLNDVNMSAHYCGYNPPPPNFKTFFPEKYKDRLQRLPNFG
KLRSSWEIHRRPTLVVLHVFADDIGALDKWIDVVYRLAAPGFLGGEMDFF
VDDLWQSFIFNEDDFSFSRSDEGCTVDSFPLIYAANSTGKVFFFGDFTGP
KLPDLESLRDFCDQVIKGIAEEPTARDPKVENISLDSWNELMYASDNDIA
ICFYNSLQNGAEVNSSLMANLDWLADKLKQESVLLYKMDIHGSRIPKSSS
*

MIP04624.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2014-11-26 23:20:23
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF17926-PA 307 GF17926-PA 6..235 21..250 740 58.7 Plus
Dana\GF17927-PA 462 GF17927-PA 3..129 68..201 258 41.8 Plus
Blast to dere-all-translation-r1.3.fasta performed 2014-11-26 23:20:24
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG16814-PA 300 GG16814-PA 1..231 17..247 1111 87.4 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2014-11-26 23:20:25
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH17221-PA 313 GH17221-PA 2..229 22..248 405 37.1 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-26 23:20:22
Subject Length Description Subject Range Query Range Score Percent Strand
CG14907-PA 234 CG14907-PA 1..234 17..250 1258 100 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2014-11-26 23:20:29
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM15413-PA 308 GM15413-PA 1..232 17..248 1163 92.7 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2014-11-26 23:20:29
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD20272-PA 308 GD20272-PA 1..232 17..248 1173 93.1 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2014-11-26 23:20:31
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ23882-PA 308 GJ23882-PA 6..227 29..247 373 34.5 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2014-11-26 23:20:32
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE26133-PA 302 GE26133-PA 1..231 17..247 1059 81.8 Plus

MIP04624.hyp Sequence

Translation from 0 to 752

> MIP04624.hyp
STAPQFHLVGQLNDVNMSAHYCGYNPPPPNFKTFFPEKYKDRLQRLPNFG
KLRSSWEIHRRPTLVVLHVFADDIGALDKWIDVVYRLAAPGFLGGEMDFF
VDDLWQSFIFNEDDFSFSRSDEGCTVDSFPLIYAANSTGKVFFFGDFTGP
KLPDLESLRDFCDQVIKGIAEEPTARDPKVENISLDSWNELMYASDNDIA
ICFYNSLQNGAEVNSSLMANLDWLADKLKQESVLLYKMDIHGSRIPKSSS
*

MIP04624.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:39:46
Subject Length Description Subject Range Query Range Score Percent Strand
CG14907-PA 234 CG14907-PA 1..234 17..250 1258 100 Plus