Clone MIP04749 Report

Search the DGRC for MIP04749

Clone and Library Details

Library:MIP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by:
Date Registered:2008-10-08
Comments:
Original Plate Number:47
Well:49
Vector:pOT2
Associated Gene/TranscriptCG17122-RA
Protein status:MIP04749.pep: gold
Sequenced Size:1918

Clone Sequence Records

MIP04749.complete Sequence

1918 bp assembled on 2009-04-04

GenBank Submission: BT081961.1

> MIP04749.complete
ACAGTCAATTCTGATAACGAACAGCAGCCTCAAAAATGCCGCCGAAAGTG
AAGAAGGAGAAGAAGGATGTGAACAAGGTGACCCAGGTGGACAGAACCTT
CTACGAGCTGACCATCACGGATCTCAACCAGAAACTAGCTCGACTGCGAT
CCCACGTGACCACCGTCGATGAGTCCAACATCACGCTGACCGAGAAACTC
AAGGAAGTGGAGGCCGATGGCGTCGACGTGGCCGCTCACTTGGAACGCAC
CCTGGCGGAGAGGAATAACTCGATCACCGAACTGGAGGAGCGCCTGGTAG
AGATCACCAAGGTGCGGGATGTGGAGAACCGCGTGGCACAGGAGAAGATC
GGCGACTTGGAGTCGAAATACAAGGCCATGCACGACCAGTTGACCTCCGA
AATAAAGCTGCTTAATGGCAAGCTGAATTCCCTCGACGAGTTCCGCATCC
AGAGGGATGTCCTGTTGGCCAAGTTCGATGAGCAGGAGGCGGATCTCAAT
GAGCGCGAGAAGGATCACAAGGAGGCGCTCTATAATATGGAACAACGAGC
TGTGGTGGAGAAGGATGCGCTAAAAAAGGAGGTCGAACAGAAGCTGCTGC
AAGTTTCCGAGGACTTCACCCGGTCCAGTGAGATCCGCAACGCTGGCTAC
ACCCGCCGCCTGATTCGTGAGAACATAGCCCTGCAAAAGGAGATCGATCT
ACTGGTCATGTCCCAGATAAAACTGCAGCAGGCATATACCAACCAGAAGT
CCAAGCACAAGGAGATGGAGGAGCAGTACAGTGCCCTCGATCAAATCAAA
AACGAGCTGGTCCGCAACTCCGTGAACAAGATCAAAATCATTGAGGGTCT
GACCAGGAACTACGAGAAACTGAAAGCCAAGTACGTGGAGGTACTGCGCT
ACAAGAAGGCCTATGAATCCCTTCTCCAAGCTGAAAAGTGCGAGAATGTC
AAGCAAAAGGATGCGGCCGGAAAACTCCGGACCCTGGCCAAGCGAATGGA
GATTTTGGATCTGGACAATCGAAATCTGGAGGTGGTCCATGCCCAGCACG
AGATCGAGATTACTCGACTGCGTGGAGTCATTCAAGAGATCAAGTGCACT
GTGCGGGATGCGATTGTGGCGGAGCAGGCAGCCAAGAAATTCCCGGAGAG
ATTAGTCGAGGCCAATGTGGATGATCCCGCAATGATAAATGAAGTTCGGG
AGGAGGCCATATCCCTTTGCAAGCTGAAACGCAGCGATTTGCTCTCCCAG
CTTATGAGCATCGTGAGCTCCCATTCGGAGGAGCTTCCGAAGACTCCATC
GATTGCCTCCATTGTCAGTGCCACCTCATCGCTGTATGCTCCAGGTAAAA
TGGGCTTCATGCCCACGAGACCCAAAGCAACGCCATTCGACGCCTTCCGC
AGCGAGGTCATCGAACAGGAGCCGGATCGCACCGTTCCGGAGGATCTGCA
AAAGCAGAAGATGCAGGATCGGCTAATGACCTCGTTGCGAGGTGACGAGA
ATACCATAATCGATGTGGAATTCGGCACTACTCTATACGTTTCATCATCG
CGCGAGGACGATCTCATTGAGGTGGAGGAGGAGCCACTGGAGGAGCCAGA
GGGTTCCACCAGCTCCATGTCTGTGAAGAAGGCCAGCAGTGAGGGTTCAG
TGGCTCCGCCCGAAACCGTACCGCTAGCCGTTTCCGCATCCTCGAAGGAC
ATCAAGGGTGCTCCCAGCATTGGGGCTCTGGACACACTGACGGCCACATC
CAAAATGACGGGTGTTACCAACGAGGACGAGGGCGAGGAGGAAGGCGAGG
AGGAGGACTTCGATGTGCAGTTCGTCTACTAGAGGGATATGAAAATTGAG
TTTACTTGTAGTTCCAATTTTGTTGAGTCTTGAATAAATATGTGCAAAGT
CAAAAAAAAAAAAAAAAA

MIP04749.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 21:29:05
Subject Length Description Subject Range Query Range Score Percent Strand
CG17122-RA 1952 CG17122-RA 47..1952 1..1906 9530 100 Plus
Blast to d_melanogaster_OreR.fa performed 2014-11-27 10:17:04
Subject Length Description Subject Range Query Range Score Percent Strand
chr3L 24539361 chr3L 20262541..20264441 1901..1 9445 99.8 Minus
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 10:17:00
Subject Length Description Subject Range Query Range Score Percent Strand
CG17122-RA 1797 CG17122-PA 1..1797 36..1832 8985 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 20:03:53 has no hits.
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 10:17:00
Subject Length Description Subject Range Query Range Score Percent Strand
CG17122-RA 1947 CG17122-RA 47..1947 1..1901 9505 100 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 10:17:03
Subject Length Description Subject Range Query Range Score Percent Strand
CG17122-PA 598 CG17122-PA 1..598 36..1829 2630 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 10:16:58
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 20273384..20275289 1906..1 9530 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:45:44
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28103327 3L 20266484..20268389 1906..1 9530 100 Minus
Blast to na_te.dros performed on 2014-11-27 10:16:58 has no hits.

MIP04749.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2014-11-27 11:39:42 Download gff for MIP04749.complete
Subject Subject Range Query Range Percent Splice Strand
chr3L 20262541..20264441 1..1901 97   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2009-10-19 18:08:35 Download gff for MIP04749.complete
Subject Subject Range Query Range Percent Splice Strand
CG17122-RA 1..1797 36..1832 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 21:43:31 Download gff for MIP04749.complete
Subject Subject Range Query Range Percent Splice Strand
CG17122-RA 1..1797 36..1832 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 16:40:06 Download gff for MIP04749.complete
Subject Subject Range Query Range Percent Splice Strand
CG17122-RA 1..1797 36..1832 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 11:39:42 Download gff for MIP04749.complete
Subject Subject Range Query Range Percent Splice Strand
CG17122-RA 1..1797 36..1832 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2009-04-04 15:21:19 Download gff for MIP04749.complete
Subject Subject Range Query Range Percent Splice Strand
CG17122-RA 47..1947 1..1901 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 21:43:31 Download gff for MIP04749.complete
Subject Subject Range Query Range Percent Splice Strand
CG17122-RA 47..1947 1..1901 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 16:40:06 Download gff for MIP04749.complete
Subject Subject Range Query Range Percent Splice Strand
CG17122-RA 47..1947 1..1901 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 11:39:42 Download gff for MIP04749.complete
Subject Subject Range Query Range Percent Splice Strand
CG17122-RA 47..1947 1..1901 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 11:39:42 Download gff for MIP04749.complete
Subject Subject Range Query Range Percent Splice Strand
3L 20273389..20275289 1..1901 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 16:40:06 Download gff for MIP04749.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 20266489..20268389 1..1901 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 19:18:31 Download gff for MIP04749.complete
Subject Subject Range Query Range Percent Splice Strand
3L 20266489..20268389 1..1901 100   Minus

MIP04749.pep Sequence

Translation from 35 to 1831

> MIP04749.pep
MPPKVKKEKKDVNKVTQVDRTFYELTITDLNQKLARLRSHVTTVDESNIT
LTEKLKEVEADGVDVAAHLERTLAERNNSITELEERLVEITKVRDVENRV
AQEKIGDLESKYKAMHDQLTSEIKLLNGKLNSLDEFRIQRDVLLAKFDEQ
EADLNEREKDHKEALYNMEQRAVVEKDALKKEVEQKLLQVSEDFTRSSEI
RNAGYTRRLIRENIALQKEIDLLVMSQIKLQQAYTNQKSKHKEMEEQYSA
LDQIKNELVRNSVNKIKIIEGLTRNYEKLKAKYVEVLRYKKAYESLLQAE
KCENVKQKDAAGKLRTLAKRMEILDLDNRNLEVVHAQHEIEITRLRGVIQ
EIKCTVRDAIVAEQAAKKFPERLVEANVDDPAMINEVREEAISLCKLKRS
DLLSQLMSIVSSHSEELPKTPSIASIVSATSSLYAPGKMGFMPTRPKATP
FDAFRSEVIEQEPDRTVPEDLQKQKMQDRLMTSLRGDENTIIDVEFGTTL
YVSSSREDDLIEVEEEPLEEPEGSTSSMSVKKASSEGSVAPPETVPLAVS
ASSKDIKGAPSIGALDTLTATSKMTGVTNEDEGEEEGEEEDFDVQFVY*

MIP04749.pep Blast Records

Blast to dgri-all-translation-r1.3.fasta performed 2014-11-28 08:04:06
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH18006-PA 897 GH18006-PA 1..110 439..547 168 57.4 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 08:04:01
Subject Length Description Subject Range Query Range Score Percent Strand
CG17122-PA 598 CG17122-PA 1..598 1..598 2957 100 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2014-11-28 08:04:15
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK18286-PA 599 GK18286-PA 1..599 1..598 2063 71.1 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2014-11-28 08:04:16
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE22754-PA 1388 GE22754-PA 487..612 468..593 415 83.3 Plus

MIP04749.hyp Sequence

Translation from 35 to 1831

> MIP04749.hyp
MPPKVKKEKKDVNKVTQVDRTFYELTITDLNQKLARLRSHVTTVDESNIT
LTEKLKEVEADGVDVAAHLERTLAERNNSITELEERLVEITKVRDVENRV
AQEKIGDLESKYKAMHDQLTSEIKLLNGKLNSLDEFRIQRDVLLAKFDEQ
EADLNEREKDHKEALYNMEQRAVVEKDALKKEVEQKLLQVSEDFTRSSEI
RNAGYTRRLIRENIALQKEIDLLVMSQIKLQQAYTNQKSKHKEMEEQYSA
LDQIKNELVRNSVNKIKIIEGLTRNYEKLKAKYVEVLRYKKAYESLLQAE
KCENVKQKDAAGKLRTLAKRMEILDLDNRNLEVVHAQHEIEITRLRGVIQ
EIKCTVRDAIVAEQAAKKFPERLVEANVDDPAMINEVREEAISLCKLKRS
DLLSQLMSIVSSHSEELPKTPSIASIVSATSSLYAPGKMGFMPTRPKATP
FDAFRSEVIEQEPDRTVPEDLQKQKMQDRLMTSLRGDENTIIDVEFGTTL
YVSSSREDDLIEVEEEPLEEPEGSTSSMSVKKASSEGSVAPPETVPLAVS
ASSKDIKGAPSIGALDTLTATSKMTGVTNEDEGEEEGEEEDFDVQFVY*

MIP04749.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:28:25
Subject Length Description Subject Range Query Range Score Percent Strand
CG17122-PA 598 CG17122-PA 1..598 1..598 2957 100 Plus