Clone MIP04810 Report

Search the DGRC for MIP04810

Clone and Library Details

Library:MIP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by:
Date Registered:2008-10-08
Comments:
Original Plate Number:48
Well:10
Vector:pOT2
Associated Gene/TranscriptCG14523-RA
Protein status:MIP04810.pep: gold
Sequenced Size:2104

Clone Sequence Records

MIP04810.complete Sequence

2104 bp assembled on 2009-04-06

GenBank Submission: BT081979.1

> MIP04810.complete
GGAGTGTTCGCCATGGAGAACTTTGGTATCGCACATGCCCTGCTCCAGCT
ACTGCTGCTCCATCTGGTGGGAAGTGGTCGAGGTCACCTGCTAACTGGTC
AACCGGCCATTGACCTGCGCATCCAGGCACGGGAGCAGCTGATCTCGCAG
TCCAATGACAGCGCCTATGTCCAGCGACTGATGCGTCTGTCCAAGTCCGC
CGAAATGCGCAGCTATATGCAGCAGGACGCGGATGCCTGCGAAAACTTCT
ACGACTACAGCTGCGGAAATTGGCCCCAGATCAATCCGGCCAACGATGCC
TATCCCCGGGAGACGAACTTCGTGCAGCTGCTGCTCAAGGCCTATAGCCA
CAAGCAGCAGCGTCTAATGGAGCAGCCGGCGAACGTGGAAACGGATGAGG
TGGCCGTGCTCCGACTGAAGGAGTTCTATGCCAGTTGCCTGCTCTTTCGA
CAGGTACCGGAGGATCTCTACAGACGTCAGTTGCAGGAAATTGTGGCTGA
TTTCGGACGCATGCCCGTCCTAAGTCTCCCGGGTCAGGAGTGGCCAGCCG
AGGAGTTCGATTGGCTGGACACAGTGGCGCGAATAAAGCGGCAGTACGGC
TTTGACATCCTTTTGCTCTTTCAGCAGTCGGCGGATCGCATATACGTGGG
ACAGCCGAAGCAGATTCTTCCGGAGGCCAACAGAAAGGCCGTGGCAGAAG
ATATAGCCAATCATTTGGAACGTCACTTGGGTGTGGATCCCAAAGTGGCC
GTAACAACGGCAAGGGAAATTACAGAGTTTGAGCAAAAGATTGCCGCCAT
TATGGTGGATCGTCGAGTTGGAGTGATGTCCAAATTGTACACTCCAAGTG
ACGCGGACTACGTTGATGTCTCAAAACTCACCCAGTTCGTGGAAACTGTC
CTTGACCGGGAGTTGTTGGCCAACGAGTCCCTATATCAGCATGTTCCTGA
TTATCTTATGAAAATAGATGAGCTGGTGACGGAGACACCACCACACGTAC
TGGCTAACTATGTCTTCAATGAGCTTTTAAAGCACTTCTACTACGAGCGA
GCGGAATCCGTTGTGGAGCAGTGCGTCAGTCGGGTCAGGGATCTCTTTGG
CGAGCTCCTTGACCACATGTTGTTCGAGCAGTATGAAGATGAAGGTACCC
TGAAGGATATATATGTAGTCTGGCAGCAGTTACAGCGCAGCTTTAGAGGT
GTGTTACAAAACTCTTCAGCAAATTGGTTGGTTCCGGAGACGAGGGAACA
ACTACTAGAGCAGTTGAATACAACCAGTCTGGTGATCAATGGATATGCCG
AAGTCAATTTCACGCAGCGATATGAGGAGCTGCACCTGAAACCTAGAGAT
TATCTTCACAATCTGAGGACCATACTTAACCATCAGAGTTTGAGGGTCAA
GGTGAAGACTCAGACATCGGTCACCTATGATCCTGTGGGAAAGAGAGTCC
TGCTACCAGTTGCTCTGCTCCAACCGAACTTCCTGTGGTCCCGCTACTAT
CCAAAAGCAGTGCGGTATGGCAGTCTGGGCACCTTGCTGGCCCAGCAGTT
GGCACACAGCTTGGAAGATGCATCCAAGTGGGATGCCAAGTCCTTTGCTG
AGTACTCCAAAAGGAAGTCCTGCTTCAAGGAGCAGTACGGTAGACTGCGG
CTCAATGGACATTACTTGCCGGAGAGCGATCTGCAGGCGGAGAACATAGC
CGACAATCTGGCCATTCAGGTGGCCTACCATGCCTACCGAAGGCTTCTGG
CGGAACTGGACCCATCCTTCTTGGGCTCCGAGTCCTTGCCACAACTCAAC
CTTGGCTCCCGAAGACTGTTCTTCCTCAGCTTTGCCCAGTTATGGTGCAA
TGATGCCAATGAACAGTTCCGGGACAAGCAATCCCTGTTTTTGGGCACTC
CCAATGCCCTCCGCGTGCTGGGAGCACTATCGAACTTTAGAGCCTTTGGA
CGGGACTTTAACTGCGGGACCGCTAGCAGGATGACCTCTCCCCAGAAGTG
TCAGCTCTTCGCCGTTAACCTGGATTAGTTAGGACATCATTTAAAGTACT
CTGAACTACAATAAATTCTACCCATAATAAAGACTAAAAAAAAAAAAAAA
AAAA

MIP04810.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 21:29:14
Subject Length Description Subject Range Query Range Score Percent Strand
CG14523-RA 2228 CG14523-RA 134..2220 1..2087 10420 99.9 Plus
Blast to d_melanogaster_OreR.fa performed 2014-11-27 10:18:04
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 24701014..24703098 2085..1 10155 99.1 Minus
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 10:18:00
Subject Length Description Subject Range Query Range Score Percent Strand
CG14523-RA 2016 CG14523-PA 1..2016 13..2028 10080 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 20:04:04 has no hits.
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 10:17:59
Subject Length Description Subject Range Query Range Score Percent Strand
CG14523-RA 2099 CG14523-RA 15..2099 1..2085 10410 100 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 10:18:03
Subject Length Description Subject Range Query Range Score Percent Strand
CG14523-PA 671 CG14523-PA 1..671 13..2025 3352 100 Plus
CG14526-PC 707 CG14526-PC 39..707 157..2010 909 32.1 Plus
CG14527-PA 700 CG14527-PA 30..700 151..2010 870 31.2 Plus
CG14528-PA 682 CG14528-PA 35..682 160..2010 779 29.9 Plus
CG14529-PA 681 CG14529-PA 36..681 172..2010 742 29.9 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 10:17:58
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 28878022..28880108 2087..1 10420 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:45:53
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 28618853..28620939 2087..1 10420 99.9 Minus
Blast to na_te.dros performed on 2014-11-27 10:17:58 has no hits.

MIP04810.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2014-11-27 11:40:05 Download gff for MIP04810.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 24701014..24703098 1..2085 99   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2009-10-19 18:08:41 Download gff for MIP04810.complete
Subject Subject Range Query Range Percent Splice Strand
CG14523-RA 1..2016 13..2028 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 21:43:45 Download gff for MIP04810.complete
Subject Subject Range Query Range Percent Splice Strand
CG14523-RA 1..2016 13..2028 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 16:40:21 Download gff for MIP04810.complete
Subject Subject Range Query Range Percent Splice Strand
CG14523-RA 1..2016 13..2028 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 11:40:05 Download gff for MIP04810.complete
Subject Subject Range Query Range Percent Splice Strand
CG14523-RA 1..2016 13..2028 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2009-04-06 13:55:21 Download gff for MIP04810.complete
Subject Subject Range Query Range Percent Splice Strand
CG14523-RA 134..2218 1..2085 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 21:43:45 Download gff for MIP04810.complete
Subject Subject Range Query Range Percent Splice Strand
CG14523-RA 134..2218 1..2085 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 16:40:21 Download gff for MIP04810.complete
Subject Subject Range Query Range Percent Splice Strand
CG14523-RA 15..2099 1..2085 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 11:40:05 Download gff for MIP04810.complete
Subject Subject Range Query Range Percent Splice Strand
CG14523-RA 15..2099 1..2085 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 11:40:05 Download gff for MIP04810.complete
Subject Subject Range Query Range Percent Splice Strand
3R 28878024..28880108 1..2085 99   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 16:40:21 Download gff for MIP04810.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 24703746..24705830 1..2085 99   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 19:18:47 Download gff for MIP04810.complete
Subject Subject Range Query Range Percent Splice Strand
3R 28618855..28620939 1..2085 99   Minus

MIP04810.pep Sequence

Translation from 0 to 2027

> MIP04810.pep
GVFAMENFGIAHALLQLLLLHLVGSGRGHLLTGQPAIDLRIQAREQLISQ
SNDSAYVQRLMRLSKSAEMRSYMQQDADACENFYDYSCGNWPQINPANDA
YPRETNFVQLLLKAYSHKQQRLMEQPANVETDEVAVLRLKEFYASCLLFR
QVPEDLYRRQLQEIVADFGRMPVLSLPGQEWPAEEFDWLDTVARIKRQYG
FDILLLFQQSADRIYVGQPKQILPEANRKAVAEDIANHLERHLGVDPKVA
VTTAREITEFEQKIAAIMVDRRVGVMSKLYTPSDADYVDVSKLTQFVETV
LDRELLANESLYQHVPDYLMKIDELVTETPPHVLANYVFNELLKHFYYER
AESVVEQCVSRVRDLFGELLDHMLFEQYEDEGTLKDIYVVWQQLQRSFRG
VLQNSSANWLVPETREQLLEQLNTTSLVINGYAEVNFTQRYEELHLKPRD
YLHNLRTILNHQSLRVKVKTQTSVTYDPVGKRVLLPVALLQPNFLWSRYY
PKAVRYGSLGTLLAQQLAHSLEDASKWDAKSFAEYSKRKSCFKEQYGRLR
LNGHYLPESDLQAENIADNLAIQVAYHAYRRLLAELDPSFLGSESLPQLN
LGSRRLFFLSFAQLWCNDANEQFRDKQSLFLGTPNALRVLGALSNFRAFG
RDFNCGTASRMTSPQKCQLFAVNLD*

MIP04810.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2014-11-28 08:09:38
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF17983-PA 674 GF17983-PA 11..674 14..675 2410 67.7 Plus
Dana\GF17017-PA 691 GF17017-PA 21..691 51..670 892 32 Plus
Dana\GF17991-PA 681 GF17991-PA 23..681 45..670 741 26.9 Plus
Dana\GF17990-PA 686 GF17990-PA 40..686 58..670 720 29.1 Plus
Dana\GF18283-PA 691 GF18283-PA 35..691 56..670 609 28.2 Plus
Blast to dere-all-translation-r1.3.fasta performed 2014-11-28 08:09:40
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG11623-PA 699 GG11623-PA 1..699 15..670 938 31.8 Plus
Dere\GG11622-PA 699 GG11622-PA 10..699 28..670 906 31.6 Plus
Dere\GG11619-PA 683 GG11619-PA 35..683 54..671 772 29.8 Plus
Dere\GG11618-PA 681 GG11618-PA 36..681 58..670 732 30.4 Plus
Dere\GG12480-PA 686 GG12480-PA 17..686 41..670 575 27.1 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2014-11-28 08:09:41
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH13212-PA 692 GH13212-PA 1..692 30..670 931 30.9 Plus
Dgri\GH13201-PA 693 GH13201-PA 47..693 54..670 849 30.5 Plus
Dgri\GH20297-PA 603 GH20297-PA 1..603 30..670 743 28.2 Plus
Dgri\GH13190-PA 684 GH13190-PA 35..684 53..670 688 28 Plus
Dgri\GH18312-PA 682 GH18312-PA 27..682 56..670 634 28.1 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 08:09:37
Subject Length Description Subject Range Query Range Score Percent Strand
CG14523-PA 671 CG14523-PA 1..671 5..675 3472 100 Plus
CG14526-PC 707 CG14526-PC 7..707 12..670 911 31.3 Plus
CG14527-PA 700 CG14527-PA 30..700 51..670 870 31.2 Plus
CG14528-PA 682 CG14528-PA 35..682 54..670 779 29.9 Plus
CG14529-PA 681 CG14529-PA 36..681 58..670 742 29.9 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2014-11-28 08:09:43
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI10381-PA 675 GI10381-PA 21..675 28..671 1764 53.2 Plus
Dmoj\GI22369-PA 700 GI22369-PA 33..700 53..670 978 32.6 Plus
Dmoj\GI22368-PA 688 GI22368-PA 43..688 56..670 840 30.6 Plus
Dmoj\GI22367-PA 692 GI22367-PA 36..692 49..670 711 28.1 Plus
Dmoj\GI10776-PA 685 GI10776-PA 30..685 56..670 573 27 Plus
Blast to dper-all-translation-r1.3.fasta performed 2014-11-28 08:09:44
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL23349-PA 320 GL23349-PA 1..320 359..675 1137 65.9 Plus
Dper\GL24195-PA 709 GL24195-PA 39..709 53..670 958 33.3 Plus
Dper\GL23350-PA 271 GL23350-PA 1..246 37..282 839 63.4 Plus
Dper\GL13855-PA 689 GL13855-PA 37..689 60..670 717 29.1 Plus
Dper\GL23771-PA 685 GL23771-PA 26..685 54..670 565 26.8 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2014-11-28 08:09:45
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA13053-PA 679 GA13053-PA 1..679 5..675 2224 62.1 Plus
Dpse\GA13054-PA 709 GA13054-PA 39..709 53..670 958 33.5 Plus
Dpse\GA26947-PA 666 GA26947-PA 16..666 54..670 778 29.7 Plus
Dpse\GA26946-PA 689 GA26946-PA 37..689 60..670 715 28.8 Plus
Dpse\GA18384-PA 682 GA18384-PA 23..682 54..670 580 27 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2014-11-28 08:09:47
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM12744-PA 698 GM12744-PA 1..698 15..670 922 31.6 Plus
Dsec\GM12743-PA 700 GM12743-PA 3..700 15..670 873 29.8 Plus
Dsec\GM12742-PA 682 GM12742-PA 35..682 54..670 786 29.8 Plus
Dsec\GM23611-PA 686 GM23611-PA 36..686 60..670 571 27.2 Plus
Dsec\GM23172-PA 1040 GM23172-PA 441..1040 135..670 515 26.7 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2014-11-28 08:09:48
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD18009-PA 671 GD18009-PA 1..671 5..675 3347 95.4 Plus
Dsim\GD21387-PA 685 GD21387-PA 15..685 53..670 904 32.1 Plus
Dsim\GD21385-PA 598 GD21385-PA 2..598 105..670 690 29.8 Plus
Dsim\GD18421-PA 686 GD18421-PA 36..686 60..670 569 27.1 Plus
Dsim\GD20045-PA 1040 GD20045-PA 441..1040 135..670 512 26.8 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2014-11-28 08:09:50
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ24403-PA 710 GJ24403-PA 41..710 53..670 986 33.6 Plus
Dvir\GJ24402-PA 670 GJ24402-PA 24..670 56..670 843 31 Plus
Dvir\GJ24401-PA 687 GJ24401-PA 35..687 53..670 703 28.6 Plus
Dvir\GJ14375-PA 685 GJ14375-PA 30..685 56..670 621 27.3 Plus
Dvir\GJ24287-PA 1056 GJ24287-PA 457..1056 135..670 490 26.3 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2014-11-28 08:09:51
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK22625-PA 669 GK22625-PA 5..669 13..670 1952 55.7 Plus
Dwil\GK22544-PA 686 GK22544-PA 24..686 60..670 847 32.2 Plus
Dwil\GK22543-PA 681 GK22543-PA 30..681 54..670 786 29.3 Plus
Dwil\GK22542-PA 685 GK22542-PA 44..685 60..670 725 30.2 Plus
Dwil\GK22548-PA 651 GK22548-PA 1..651 57..670 686 28 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2014-11-28 08:09:52
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE23808-PA 1025 GE23808-PA 356..1025 53..670 943 32.6 Plus
Dyak\GE19949-PA 697 GE19949-PA 10..697 28..670 863 30.9 Plus
Dyak\GE23807-PA 682 GE23807-PA 35..682 54..670 755 29.4 Plus
Dyak\GE23806-PA 681 GE23806-PA 36..681 58..670 680 30.7 Plus
Dyak\GE24002-PA 686 GE24002-PA 36..686 60..670 566 27.5 Plus
Dyak\GE23808-PA 1025 GE23808-PA 10..338 28..346 334 28.4 Plus

MIP04810.hyp Sequence

Translation from 0 to 2027

> MIP04810.hyp
GVFAMENFGIAHALLQLLLLHLVGSGRGHLLTGQPAIDLRIQAREQLISQ
SNDSAYVQRLMRLSKSAEMRSYMQQDADACENFYDYSCGNWPQINPANDA
YPRETNFVQLLLKAYSHKQQRLMEQPANVETDEVAVLRLKEFYASCLLFR
QVPEDLYRRQLQEIVADFGRMPVLSLPGQEWPAEEFDWLDTVARIKRQYG
FDILLLFQQSADRIYVGQPKQILPEANRKAVAEDIANHLERHLGVDPKVA
VTTAREITEFEQKIAAIMVDRRVGVMSKLYTPSDADYVDVSKLTQFVETV
LDRELLANESLYQHVPDYLMKIDELVTETPPHVLANYVFNELLKHFYYER
AESVVEQCVSRVRDLFGELLDHMLFEQYEDEGTLKDIYVVWQQLQRSFRG
VLQNSSANWLVPETREQLLEQLNTTSLVINGYAEVNFTQRYEELHLKPRD
YLHNLRTILNHQSLRVKVKTQTSVTYDPVGKRVLLPVALLQPNFLWSRYY
PKAVRYGSLGTLLAQQLAHSLEDASKWDAKSFAEYSKRKSCFKEQYGRLR
LNGHYLPESDLQAENIADNLAIQVAYHAYRRLLAELDPSFLGSESLPQLN
LGSRRLFFLSFAQLWCNDANEQFRDKQSLFLGTPNALRVLGALSNFRAFG
RDFNCGTASRMTSPQKCQLFAVNLD*

MIP04810.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 15:35:10
Subject Length Description Subject Range Query Range Score Percent Strand
CG14523-PA 671 CG14523-PA 1..671 5..675 3472 100 Plus
CG14526-PC 707 CG14526-PC 7..707 12..670 911 31.3 Plus
CG14527-PA 700 CG14527-PA 30..700 51..670 870 31.2 Plus
CG14528-PA 682 CG14528-PA 35..682 54..670 779 29.9 Plus
CG14529-PA 681 CG14529-PA 36..681 58..670 742 29.9 Plus