Clone MIP04834 Report

Search the DGRC for MIP04834

Clone and Library Details

Library:MIP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by:
Date Registered:2008-10-08
Comments:
Original Plate Number:48
Well:34
Vector:pOT2
Associated Gene/TranscriptCG15525-RA
Protein status:MIP04834.pep: gold
Sequenced Size:620

Clone Sequence Records

MIP04834.complete Sequence

620 bp assembled on 2009-04-03

GenBank Submission: BT081396.1

> MIP04834.complete
CCCAGACTCAAATTTAAATTAATTGTATTATCTTGAGAACAAACTTCACA
TGGGCATGATGGACAACAATGGCGTCGGCAAGCTGACACAAGAATCTCTA
AAACGCAAGGAGCGTCTGCAAAAACTCCGGGAACAAGTGCAAAACAAAGG
AGGAGACGCTGCCGAGTCCATTGAAAAGTTACCCAAACCAGTTTTCCGCA
GCTACAAGCCCCAGAATGAGACCACCGATGGCGAGATTCTAGCACAGGAA
CCCACGGGCAACATAGAATCAGCTGTGGAGGATCAATTGAGTCTGCTCCA
GCAGCCCATGGTGATAGATGAGATTGACATAACCAACCTGGCTCCCCGAA
AACCCGACTGGGATCTGAAGCGGGATGCCAGCAAAAAGTTGGAGCGACTG
GAACGACGTACCCAGAAAGCTATTGCTGAACTCATCCGTGAGCGACTGAA
ACTGAACCAAATGGAGGATATCAGCCAAGCGGTGAATGTGGCCACGGCTC
ATGCAGGTGAAAGTGTTCAGGAGGATTATGACTAGAGCTGAATAATACAA
CTAACTTTACTAAACTGGTACAAAAAACGAAAAAATGCATTAACAATAAG
TAAAAAAAAAAAAAAAAAAA

MIP04834.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 21:28:34
Subject Length Description Subject Range Query Range Score Percent Strand
CG15525-RA 745 CG15525-RA 145..745 1..601 3005 100 Plus
sas-6-RA 1684 sas-6-RA 1569..1684 605..490 580 100 Minus
Blast to d_melanogaster_OreR.fa performed 2014-11-27 03:52:52
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 25819341..25819755 601..187 2030 99.3 Minus
chr3R 27901430 chr3R 25819818..25820003 186..1 885 98.4 Minus
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 03:52:49
Subject Length Description Subject Range Query Range Score Percent Strand
CG15525-RA 486 CG15525-PA 1..486 50..535 2430 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 20:04:07 has no hits.
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 03:52:48
Subject Length Description Subject Range Query Range Score Percent Strand
CG15525-RA 654 CG15525-RA 54..654 1..601 3005 100 Plus
Sas-6-RA 1507 CG15524-RA 1434..1507 601..528 370 100 Minus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 03:52:51
Subject Length Description Subject Range Query Range Score Percent Strand
CG15525-PA 161 CG15525-PA 1..161 50..532 808 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 03:52:46
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 29996957..29997375 605..187 2095 100 Minus
3R 32079331 3R 29997438..29997623 186..1 930 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:45:17
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 29737788..29738206 605..187 2095 100 Minus
3R 31820162 3R 29738269..29738454 186..1 930 100 Minus
Blast to na_te.dros performed on 2014-11-27 03:52:46 has no hits.

MIP04834.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2014-11-27 05:32:25 Download gff for MIP04834.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 25819818..25820003 1..186 98   Minus
chr3R 25819341..25819755 187..601 99 <- Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2009-10-19 18:08:16 Download gff for MIP04834.complete
Subject Subject Range Query Range Percent Splice Strand
CG15525-RB 1..486 50..535 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 21:42:47 Download gff for MIP04834.complete
Subject Subject Range Query Range Percent Splice Strand
CG15525-RA 1..486 50..535 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 07:22:21 Download gff for MIP04834.complete
Subject Subject Range Query Range Percent Splice Strand
CG15525-RA 1..486 50..535 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 05:32:25 Download gff for MIP04834.complete
Subject Subject Range Query Range Percent Splice Strand
CG15525-RA 1..486 50..535 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2009-04-03 09:27:32 Download gff for MIP04834.complete
Subject Subject Range Query Range Percent Splice Strand
CG15525-RA 54..654 1..601 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 21:42:47 Download gff for MIP04834.complete
Subject Subject Range Query Range Percent Splice Strand
CG15525-RA 55..655 1..601 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 07:22:21 Download gff for MIP04834.complete
Subject Subject Range Query Range Percent Splice Strand
CG15525-RA 54..654 1..601 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 05:32:25 Download gff for MIP04834.complete
Subject Subject Range Query Range Percent Splice Strand
CG15525-RA 54..654 1..601 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 05:32:25 Download gff for MIP04834.complete
Subject Subject Range Query Range Percent Splice Strand
3R 29997438..29997623 1..186 100   Minus
3R 29996961..29997375 187..601 100 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 07:22:21 Download gff for MIP04834.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 25823160..25823345 1..186 100   Minus
arm_3R 25822683..25823097 187..601 100 <- Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 19:17:40 Download gff for MIP04834.complete
Subject Subject Range Query Range Percent Splice Strand
3R 29738269..29738454 1..186 100   Minus
3R 29737792..29738206 187..601 100 <- Minus

MIP04834.pep Sequence

Translation from 49 to 534

> MIP04834.pep
MGMMDNNGVGKLTQESLKRKERLQKLREQVQNKGGDAAESIEKLPKPVFR
SYKPQNETTDGEILAQEPTGNIESAVEDQLSLLQQPMVIDEIDITNLAPR
KPDWDLKRDASKKLERLERRTQKAIAELIRERLKLNQMEDISQAVNVATA
HAGESVQEDYD*

MIP04834.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2014-11-26 23:20:46
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF16213-PA 157 GF16213-PA 1..157 4..161 698 86.7 Plus
Blast to dere-all-translation-r1.3.fasta performed 2014-11-26 23:20:47
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG11979-PA 161 GG11979-PA 1..161 1..161 716 92.5 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2014-11-26 23:20:48
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH22169-PA 160 GH22169-PA 1..160 3..161 646 78.1 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-26 23:20:45
Subject Length Description Subject Range Query Range Score Percent Strand
CG15525-PA 161 CG15525-PA 1..161 1..161 808 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2014-11-26 23:20:49
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI21967-PA 162 GI21967-PA 1..162 1..160 611 74.7 Plus
Blast to dper-all-translation-r1.3.fasta performed 2014-11-26 23:20:49
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL13490-PA 159 GL13490-PA 1..159 4..161 636 79.9 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2014-11-26 23:20:50
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA13783-PA 159 GA13783-PA 1..159 4..161 636 79.9 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2014-11-26 23:20:51
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM12197-PA 161 GM12197-PA 1..161 1..161 803 96.9 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2014-11-26 23:20:52
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD17487-PA 161 GD17487-PA 1..161 1..161 818 98.1 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2014-11-26 23:20:53
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ14326-PA 162 GJ14326-PA 1..162 1..161 635 77.3 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2014-11-26 23:20:54
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK14082-PA 160 GK14082-PA 4..160 5..161 689 82.2 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2014-11-26 23:20:54
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE10404-PA 161 GE10404-PA 1..161 1..161 793 93.8 Plus

MIP04834.hyp Sequence

Translation from 49 to 534

> MIP04834.hyp
MGMMDNNGVGKLTQESLKRKERLQKLREQVQNKGGDAAESIEKLPKPVFR
SYKPQNETTDGEILAQEPTGNIESAVEDQLSLLQQPMVIDEIDITNLAPR
KPDWDLKRDASKKLERLERRTQKAIAELIRERLKLNQMEDISQAVNVATA
HAGESVQEDYD*

MIP04834.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:26:50
Subject Length Description Subject Range Query Range Score Percent Strand
CG15525-PA 161 CG15525-PA 1..161 1..161 808 100 Plus