Clone MIP04866 Report

Search the DGRC for MIP04866

Clone and Library Details

Library:MIP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by:
Date Registered:2008-10-08
Comments:
Original Plate Number:48
Well:66
Vector:pOT2
Associated Gene/TranscriptCG18171-RA
Protein status:MIP04866.pep: gold
Sequenced Size:2556

Clone Sequence Records

MIP04866.complete Sequence

2556 bp assembled on 2009-04-08

GenBank Submission: BT082009.1

> MIP04866.complete
CAACACATTAAAGTCAAACAAATACTCCTCAAACAAAAAGCATACAAACA
AAAAAAAAAAATAGGAAAAAATAAAAAATACCATAAATAGCTCTACACCA
CACACATCTTGGAACGTATAGGATGGAGGATGAGGACTCAGATTACTTGC
CGCTGCCGAACACCAATAGCTTGAGTATTCCGAATGATCCGGTCATGCTG
GCCGTGTACGAGCTTTACAAGCCGCCCCTGACCGCCAATCGGAATTTACT
CTCGGAGCGTAATCGGGAATTCTTCGCAGAGGCGTTTAACGATGCCGACC
AAGTGCCCACTTTGGCGGATCTCTGCGTCCGACAGATGGCTAAACGTGGA
AATGCCAACGTGCCCGACGAGGTGCTTCAAGATCCGCGAAAGATGCGCAT
CCACTACGATTCACTCGATGTGGATCTGCCACTGCGTGAGTGCTACTGCG
TAGAGGATGCGAGCTACTGGAGGCGGGTGGTCCTAGCTAAGAGTTCCGAG
ACATGCCTTGCACTGAAGGGGTTGCAGGATTACGACTGGCGCGGCAAGGG
ACTGAGCCTGAAGTACATGGAGCTGGTGGAGGCCTGTCCGGCCGCCCTTT
GGCCAGAGAAAGAGATGACCGAACTAGCCGAGCTAATAAAGGATCATGTT
CGCTGCATGGACATTCGGCACCTGCAGCCGCTGTCGGAGTATGCCTTTCG
GAAAACAAAACGTGAGGAAGACGACTCGGAACCGGAAATAACATCCGAGG
AGTCTGGTGGCATGGAAATCTCCAGTGATGAGCCAATGACACCAGAAGAC
GTCGATGAGGAGGGGGAGGAAGAAGAGGAGGGGGCGGGTTCAATCGCCTC
TGACCAGAAAAGGGCAATTGGATTCAATACAAAATTTACGCTGAATGCTT
CCGACGATGAAGATGACTCCGGCAACGAGCGTCGCAAACGTCGACATGAA
CGCAACGTCGCCCGCCAACGATTGCGTGATCTGAAGGCTGCCAGGGAGGC
GGAGCATGAGGAGCGCAGGCGACGACGGTCCGAGATGCGGAAGCCCAAGG
AACCAGAGCCACGAAAGAAAAAGAAGCGAAGGCAGCGTATAAAGGGCACC
TTTGATATCCGCGTGGAGCCTGAACCAGACGATGGCGATGACAAGGTTTT
GGACAAACGCAACAAGCAAAGATATCTGACGCATCTACAACAATTAAAAT
ATCCGGAGGACGACTGCGTTCACATCGATCTTAGCTTTGTGCGCCACTTT
GTCAATCTGGTATCGCTGAACCTGGAGTTTCTGGGTCCGGCTTTGGGTAG
AAAGTACCACAAGCGGAACGTGCTCTTTTCGATCAAGGACATGGTTCGCC
TGGCTAGAGGTTTAGTGGCACTGCAGCAGCTGCAGATCTTCCGGCTTCGA
AACAGCAGACTTAATAGCTTTAAGCTATACACCGTGTGCCGGGCTCTGCG
CCTATTGCCTTTGCTGGAGGTAGTGGACTTTGGGTACAACCAGATGACTG
ACGACTGTGGCCCCGAGTTGGGAATTCTGCTGGAGCGGCCGCAAATGCTA
AAGATCCTTGAGCTGGAGTACAACCGACTGGACACGCGGGCAATGTCGGC
TATCGGAGAGGCACTGCAGCGACCGAACCTCTCCAGACTGGAGTATCTGG
GATTGGCCCACAATAAGTTGAGCGGCGACTCCCTGTCCATTTTGTGCAAC
GGTATCAAGGGCACCGAGCACGTGGAGGAGCTTAATGTGTCCGGCATCGA
GGCGAATCCTCGGACAATTGTGGACCAACTAGGCGATCTTCTGCGTCATC
ACGATCCACTTCGTCGGCTGATAATGGTGGCCATTCCTTTAGGTGCTAAG
CTAGGTACAAGACTTATATGCGCCCTCACCGCCAACATGAAGGTCACCCA
TTTTGACTGTCGCGACTGCGACTTGGACGAGCAAGAAGAGTTCGAGGCGA
ACGTGGCAGTCAGGCGAAACATTTTCTTGGGCGAAAACGGCTTTGTCACC
GATACACAGCGCTTCCCCAGCATTGGCGATGTTTTGGAGTTTGCCAAGAC
GCTGAAGCATCCGATGGTGCAAAAGGTAGAGAACGACATGGCGAGGAAGA
AGGAGTGCTTGCCGTTCTGCCCGACCCCATCGCCAAGTGTCCAAAGCCTC
GCGGCACAGTCACTAGTAGCGGAGGAGTCGGAGTACGATATTTGGCAGAT
GCTTGGCATCACAAAAAAAGTGACCAAGGACGCACCTCCGGTCGAAGAGC
TAGTGAAAAAAGTCAGTTCAGTGTCGGTGATCAAGGAACCTTTTGTCTAC
AAACCCAACGAATTCAACATAGACGAGTTCCGAGCTCACGTTTTTCTGCC
GGGGACGAGAAACAGGCACTCCTACTTCATGAAAGAAAGGCGAATGGATT
ACTAATCTGCTCGCTGACTTTTTAATTTTCATCAAAATTGAATGTTTTTA
CAATCAGCAAGAAGGAAATGATCAAATTTGTCTGAAAACCATATGCTATT
CTAGTCAAAATAATAATATCAAAAAACAAGATAAATAAAAAAAAAAAAAA
AAAAAA

MIP04866.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 21:29:47
Subject Length Description Subject Range Query Range Score Percent Strand
CG18171-RA 2511 CG18171-RA 7..2511 1..2505 12525 100 Plus
Blast to d_melanogaster_OreR.fa performed 2014-11-27 08:33:12
Subject Length Description Subject Range Query Range Score Percent Strand
chr3L 24539361 chr3L 1720176..1722707 2532..1 12660 100 Minus
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 08:33:08
Subject Length Description Subject Range Query Range Score Percent Strand
CG18171-RA 2283 CG18171-PA 1..2283 123..2405 11415 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 20:04:09 has no hits.
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 08:33:06
Subject Length Description Subject Range Query Range Score Percent Strand
CG18171-RA 2538 CG18171-RA 7..2538 1..2532 12660 100 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 08:33:10
Subject Length Description Subject Range Query Range Score Percent Strand
CG18171-PA 760 CG18171-PA 1..760 123..2402 3510 100 Plus
CG15580-PA 743 CG15580-PA 1..741 123..2390 1184 40.2 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 08:33:04
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 1720616..1723147 2532..1 12660 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:46:26
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28103327 3L 1720616..1723147 2532..1 12660 100 Minus
Blast to na_te.dros performed on 2014-11-27 08:33:05 has no hits.

MIP04866.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2014-11-27 10:11:36 Download gff for MIP04866.complete
Subject Subject Range Query Range Percent Splice Strand
chr3L 1720172..1722707 1..2536 98   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2009-10-19 18:09:05 Download gff for MIP04866.complete
Subject Subject Range Query Range Percent Splice Strand
CG18171-RA 1..2283 123..2405 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 21:44:40 Download gff for MIP04866.complete
Subject Subject Range Query Range Percent Splice Strand
CG18171-RA 1..2283 123..2405 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 10:42:50 Download gff for MIP04866.complete
Subject Subject Range Query Range Percent Splice Strand
CG18171-RA 1..2283 123..2405 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 10:11:36 Download gff for MIP04866.complete
Subject Subject Range Query Range Percent Splice Strand
CG18171-RA 1..2283 123..2405 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2009-04-08 12:26:25 Download gff for MIP04866.complete
Subject Subject Range Query Range Percent Splice Strand
CG18171-RA 7..2411 1..2405 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 21:44:40 Download gff for MIP04866.complete
Subject Subject Range Query Range Percent Splice Strand
CG18171-RA 7..2538 1..2532 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 10:42:50 Download gff for MIP04866.complete
Subject Subject Range Query Range Percent Splice Strand
CG18171-RA 7..2538 1..2532 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 10:11:36 Download gff for MIP04866.complete
Subject Subject Range Query Range Percent Splice Strand
CG18171-RA 7..2538 1..2532 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 10:11:36 Download gff for MIP04866.complete
Subject Subject Range Query Range Percent Splice Strand
3L 1720612..1723147 1..2536 99   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 10:42:50 Download gff for MIP04866.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 1720612..1723147 1..2536 99   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 19:19:49 Download gff for MIP04866.complete
Subject Subject Range Query Range Percent Splice Strand
3L 1720612..1723147 1..2536 99   Minus

MIP04866.pep Sequence

Translation from 122 to 2404

> MIP04866.pep
MEDEDSDYLPLPNTNSLSIPNDPVMLAVYELYKPPLTANRNLLSERNREF
FAEAFNDADQVPTLADLCVRQMAKRGNANVPDEVLQDPRKMRIHYDSLDV
DLPLRECYCVEDASYWRRVVLAKSSETCLALKGLQDYDWRGKGLSLKYME
LVEACPAALWPEKEMTELAELIKDHVRCMDIRHLQPLSEYAFRKTKREED
DSEPEITSEESGGMEISSDEPMTPEDVDEEGEEEEEGAGSIASDQKRAIG
FNTKFTLNASDDEDDSGNERRKRRHERNVARQRLRDLKAAREAEHEERRR
RRSEMRKPKEPEPRKKKKRRQRIKGTFDIRVEPEPDDGDDKVLDKRNKQR
YLTHLQQLKYPEDDCVHIDLSFVRHFVNLVSLNLEFLGPALGRKYHKRNV
LFSIKDMVRLARGLVALQQLQIFRLRNSRLNSFKLYTVCRALRLLPLLEV
VDFGYNQMTDDCGPELGILLERPQMLKILELEYNRLDTRAMSAIGEALQR
PNLSRLEYLGLAHNKLSGDSLSILCNGIKGTEHVEELNVSGIEANPRTIV
DQLGDLLRHHDPLRRLIMVAIPLGAKLGTRLICALTANMKVTHFDCRDCD
LDEQEEFEANVAVRRNIFLGENGFVTDTQRFPSIGDVLEFAKTLKHPMVQ
KVENDMARKKECLPFCPTPSPSVQSLAAQSLVAEESEYDIWQMLGITKKV
TKDAPPVEELVKKVSSVSVIKEPFVYKPNEFNIDEFRAHVFLPGTRNRHS
YFMKERRMDY*

MIP04866.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2014-11-28 08:37:46
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF24970-PA 775 GF24970-PA 3..771 1..756 2008 54.4 Plus
Dana\GF18632-PA 745 GF18632-PA 1..743 1..756 1312 42.1 Plus
Blast to dere-all-translation-r1.3.fasta performed 2014-11-28 08:37:47
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG14569-PA 760 GG14569-PA 3..760 2..760 3172 85.2 Plus
Dere\GG10622-PA 744 GG10622-PA 21..742 20..756 1252 41.4 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2014-11-28 08:37:49
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH13032-PA 787 GH13032-PA 1..787 1..758 1518 43.7 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 08:37:44
Subject Length Description Subject Range Query Range Score Percent Strand
CG18171-PA 760 CG18171-PA 1..760 1..760 3957 100 Plus
CG15580-PA 743 CG15580-PA 1..741 1..756 1362 41.5 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2014-11-28 08:37:50
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI18182-PA 760 GI18182-PA 1..757 1..758 1603 47.4 Plus
Blast to dper-all-translation-r1.3.fasta performed 2014-11-28 08:37:52
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL23487-PA 800 GL23487-PA 1..798 1..756 1445 42.8 Plus
Dper\GL11877-PA 627 GL11877-PA 133..581 3..452 1173 52.5 Plus
Dper\GL21425-PA 353 GL21425-PA 1..307 165..452 629 45.8 Plus
Dper\GL21423-PA 215 GL21423-PA 151..212 146..208 216 65.1 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2014-11-28 08:37:53
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA14822-PA 797 GA14822-PA 4..794 3..756 1887 49.7 Plus
Dpse\GA13826-PB 730 GA13826-PB 3..728 1..756 1454 45.5 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2014-11-28 08:37:55
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM14178-PA 759 GM14178-PA 1..759 1..759 3587 96 Plus
Dsec\GM10572-PA 743 GM10572-PA 1..741 1..756 1187 41.4 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2014-11-28 08:37:57
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD13446-PA 759 GD13446-PA 1..759 1..759 3574 95.8 Plus
Dsim\GD19564-PA 743 GD19564-PA 1..741 1..756 1191 41.5 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2014-11-28 08:37:59
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ14645-PA 785 GJ14645-PA 1..785 1..758 1634 46.5 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2014-11-28 08:38:01
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK20609-PA 777 GK20609-PA 1..773 1..760 1319 42.5 Plus
Dwil\GK17063-PA 658 GK17063-PA 123..657 235..756 1054 45.5 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2014-11-28 08:38:02
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE20923-PA 759 GE20923-PA 1..759 1..760 3339 86.3 Plus
Dyak\GE24119-PA 744 GE24119-PA 21..742 20..756 1205 39.7 Plus

MIP04866.hyp Sequence

Translation from 122 to 2404

> MIP04866.hyp
MEDEDSDYLPLPNTNSLSIPNDPVMLAVYELYKPPLTANRNLLSERNREF
FAEAFNDADQVPTLADLCVRQMAKRGNANVPDEVLQDPRKMRIHYDSLDV
DLPLRECYCVEDASYWRRVVLAKSSETCLALKGLQDYDWRGKGLSLKYME
LVEACPAALWPEKEMTELAELIKDHVRCMDIRHLQPLSEYAFRKTKREED
DSEPEITSEESGGMEISSDEPMTPEDVDEEGEEEEEGAGSIASDQKRAIG
FNTKFTLNASDDEDDSGNERRKRRHERNVARQRLRDLKAAREAEHEERRR
RRSEMRKPKEPEPRKKKKRRQRIKGTFDIRVEPEPDDGDDKVLDKRNKQR
YLTHLQQLKYPEDDCVHIDLSFVRHFVNLVSLNLEFLGPALGRKYHKRNV
LFSIKDMVRLARGLVALQQLQIFRLRNSRLNSFKLYTVCRALRLLPLLEV
VDFGYNQMTDDCGPELGILLERPQMLKILELEYNRLDTRAMSAIGEALQR
PNLSRLEYLGLAHNKLSGDSLSILCNGIKGTEHVEELNVSGIEANPRTIV
DQLGDLLRHHDPLRRLIMVAIPLGAKLGTRLICALTANMKVTHFDCRDCD
LDEQEEFEANVAVRRNIFLGENGFVTDTQRFPSIGDVLEFAKTLKHPMVQ
KVENDMARKKECLPFCPTPSPSVQSLAAQSLVAEESEYDIWQMLGITKKV
TKDAPPVEELVKKVSSVSVIKEPFVYKPNEFNIDEFRAHVFLPGTRNRHS
YFMKERRMDY*

MIP04866.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:04:02
Subject Length Description Subject Range Query Range Score Percent Strand
CG18171-PA 760 CG18171-PA 1..760 1..760 3957 100 Plus
CG15580-PA 743 CG15580-PA 1..741 1..756 1362 41.5 Plus