Clone MIP04901 Report

Search the DGRC for MIP04901

Clone and Library Details

Library:MIP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by:
Date Registered:2008-10-08
Comments:
Original Plate Number:49
Well:1
Vector:pOT2
Associated Gene/TranscriptCG14131-RA
Protein status:MIP04901.pep: gold
Sequenced Size:2552

Clone Sequence Records

MIP04901.complete Sequence

2552 bp assembled on 2009-05-14

GenBank Submission: BT082115.1

> MIP04901.complete
CGAGCTGGTTAGCGGAGCCGAGAGCGGTCCGATTAGCGACGTGGTGAAGT
TTCATTACACTTTTGGCCACAAAACAAAGGGCGACTGTGCCAACCAGCGA
CTTTATCCAGAATGCCGAGCCAACAGATTTGCTGGTGAGACAAAAAGACA
TGGCCCAGCTGAAGAATGTGGGCCAAGCAGGTCAACAGGCCGTTCTTGTT
GTTGGCCCCATGCTTGCCTCGGCCATGTTGCTCATGGGGCTGATATTCGC
GCTGCTGGGGATCAAGTTCTTCGGCTTCCGGCGGCGACTGACTTTCGAGC
GATCGCAGGTGCAGCGGCAACAGCAGAATCAGCAGCAGCAACAACCGCCG
CCACGTTACGCAGCTTTCGAATCGCAGGTTAACGGCACCGATACTGCTGT
CCATGGAGTGTTCCGACGTCGCAATCTCGAGGAATTCGAAAGCCCATGGC
CATCGGCATCAGCAACGACAGGGAACAACTTCATCAGTGGCAGTGTTCCA
AATCTGCAACTATATGGCGCCAGCCCAAGACAGCCCAAATCCACGGAAGA
ATCACCAGTTTCCTATCGAGAGAAGTCGGAGGCACAACGACTGGAGGTGC
ACAGTGAGCACTATGAATTCTACACCGCTCCACCTACCCGCAAGCCACCT
TCTCCGCCACTACAATCAGAAGTACTAGCTGAAACTGCCTCGGTAGTTTC
ACTACCTAAGATACTAGAATCCATCCCTGCTCCACCTCCCAGGACCATGA
GAGGAGCTGCTGCATCCAAGCCTTCAGGACCTGCAGCTTCTGTCGACACA
GCTCCCGAGCCTCCTAGCGAACTGGGAATGCCCAACTTCGATCACTTTGC
TGAAAAGTACGAGTTGTTTAGTGTAAAACCAACGACTGCGCCCACTAGAC
CAACACAGTTGCGAAGCAAGAACAGCGGCCGCTATGTGAAGTTCGAGCCA
GTTGATGATGTGCCGGAAATTCTCACTCCTGAGGATCCCGTTCCGGAGTT
ACTAACTCCAGATGATGGTTTGGGAGGAGCGATGTCAGTTACCGCTGTGG
TTCATAGGGGAGCCATACCCAAGGAAGAAACGGAATCGAAAGATGAACCG
CAAGCACCAAATGATACCGATCCCTTTGGGGGACCCAGCAATACAGACTC
AGCTTTTGTCGTGGAAATCATAGCAGGAAGTCCCGAAGCGGAAGCGACTC
CTAGTATACAGCCCACCTTTCAAAATGGCCTATTTGAAAACCTTGAATTA
CCACAAGGTGAGCACGACAGTGATTTCGTGCGAATACGTTCGTCATTCGT
GATGAACGAAGCCGACATCCTGGATTTGGATCAGCTGCAGCTGCCGGCGG
CCAGTAGTCCACCAGGATTTGGCAAGAGCATCGACGAGGACTGGGAGAAC
TTTGCCAACCTAGACGCCGTGGTGGATGTGCCAGAGCCCAATTGGTCTCT
GCATCCGAATAGCTTAGAGCAAGTGCCCACTGTGGAGGCGACGCTTAATG
AGGCTGCCGTCAGACTGGACGATGTGGAACAGGTGGAGGGTCTGTTCCAT
CAACTAGAGCTTATAGAGCCGAGAATGGATATATTCGAGCCTGAGCCGCC
AGCTCCCATTATAAATCCACCGCCATACGATCCTGGTCTGCCCTATCTAC
CAGATTACGAATCCCTGATGCGGCTAGATATTGCAAAGAACGGTCAGAAA
TTGCCCGACTACACCGAGGTAATGCAACAAAGGTCCAAGACATCCAATTA
TGTAATGAGCATTGAGGATCTATACGCGGATCTGGATGTTAATGAGGTGG
AGATAAACGGTTCTCAAGTCAACCAGAGCAATGAAATCCCCAATTTCGAG
GCCTTGTGCCAGGAAATGGCTGTGGTGGTGCCATCAGAGCGTCAAGCTCC
TCAGCCCGCGCCCAGGTCTACCAAATCAGCCAGATCCCTCAATGTTCGTG
GTAGTACTTCTCCCCTTGCGTGCTATCAACCTGAAGAGCTTCCCAGCTCC
AGTTCCAGTGATACCGATGGGGAGGAGGGAGCACGATCAGCTCCAGAACC
TGCCAAACGTGATCCGAAATCGCTCAAAGTCCGCTTTGATGTGGATAATC
TGCAGTACTACCAGTCCGCTGAGGTGGTAACATCAGGTGATGAGTCTGAA
GAGGATGAGCCGATGCAACAGCCAACTCCCACGCAGCGTTCGATCATTTT
TGAACCGAGTAATACTGGAGTGCCCAGCCTATTCGGATCCCAGGTCTCCC
AGGAAGACAGTGATGACGATAATGGCTTTGGACGAGCTATCAGCCAACAT
CGCTCCATGACTGCGACACTTAGGACAAACGCTGTTAGAAACAATACCGA
TGACTAGTCCGAAAACAGGAAACTGCCGCAAGTCTTGACTTCCTTAGTAA
ATACAGTATTCTATGTGTTAAATTTAGCCAAATGACTATGACCTATTTAT
GTACATACATATCACTGAAAAATTGCCATATCATGTTGACTACATAAAAT
AATAAAGTAATGGCAGGAAATCCATTTATGATAAAAAAAAAAAAAAAAAA
AA

MIP04901.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 16:26:30
Subject Length Description Subject Range Query Range Score Percent Strand
CG14131-RA 2726 CG14131-RA 163..2699 1..2537 12685 100 Plus
CG14131.a 2723 CG14131.a 163..2696 1..2537 12615 99.8 Plus
Blast to d_melanogaster_OreR.fa performed 2014-11-26 21:53:17
Subject Length Description Subject Range Query Range Score Percent Strand
chr3L 24539361 chr3L 11769313..11771385 469..2532 9850 98.5 Plus
chr3L 24539361 chr3L 11768195..11768398 176..379 1005 99.5 Plus
chr3L 24539361 chr3L 11767964..11768140 1..177 885 100 Plus
chr3L 24539361 chr3L 11769106..11769203 375..472 490 100 Plus
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 21:53:13
Subject Length Description Subject Range Query Range Score Percent Strand
CG14131-RA 2208 CG14131-PA 1..2208 150..2357 11040 100 Plus
CG14131-RB 2205 CG14131-PB 1..2205 150..2357 10960 99.9 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 20:04:12 has no hits.
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 21:53:12
Subject Length Description Subject Range Query Range Score Percent Strand
CG14131-RA 2532 CG14131-RA 1..2532 1..2532 12660 100 Plus
CG14131-RB 2529 CG14131-RB 1..2529 1..2532 12580 99.9 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-26 21:53:16
Subject Length Description Subject Range Query Range Score Percent Strand
CG14131-PA 735 CG14131-PA 1..735 150..2354 3291 100 Plus
CG14131-PB 734 CG14131-PB 1..734 150..2354 3280 98.9 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 21:53:08
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 11778422..11780490 469..2537 10345 100 Plus
3L 28110227 3L 11777304..11777507 176..379 1020 100 Plus
3L 28110227 3L 11777073..11777249 1..177 885 100 Plus
3L 28110227 3L 11778215..11778312 375..472 490 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 18:20:56
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28103327 3L 11771522..11773590 469..2537 10345 100 Plus
3L 28103327 3L 11770404..11770607 176..379 1020 100 Plus
3L 28103327 3L 11770173..11770349 1..177 885 100 Plus
3L 28103327 3L 11771315..11771412 375..472 490 100 Plus
Blast to na_te.dros performed 2014-11-26 21:53:10
Subject Length Description Subject Range Query Range Score Percent Strand
roo 9092 roo DM_ROO 9092bp 1087..1145 305..364 162 76.7 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2602..2662 298..358 161 73.8 Plus
roo 9092 roo DM_ROO 9092bp 1104..1151 298..345 150 79.2 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6778..6821 311..354 148 81.8 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6805..6851 305..351 145 78.7 Plus
roo 9092 roo DM_ROO 9092bp 1099..1148 305..354 142 76 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6881..6923 306..348 134 79.1 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2377..2424 298..345 132 75 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 1539..1575 312..348 131 83.8 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2330..2373 305..348 130 77.3 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6736..6770 311..345 130 85.7 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6757..6791 311..345 130 85.7 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 1513..1551 307..345 123 79.5 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2438..2472 311..345 121 82.9 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2480..2514 311..345 121 82.9 Plus
gypsy11 4428 gypsy11 GYPSY11 4428bp 972..1056 312..396 119 60 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2773..2826 298..351 117 68.5 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2305..2352 316..364 116 73.5 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6784..6824 305..345 115 75.6 Plus

MIP04901.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2014-11-26 22:42:40 Download gff for MIP04901.complete
Subject Subject Range Query Range Percent Splice Strand
chr3L 11769316..11771385 472..2532 98   Plus
chr3L 11769109..11769202 378..471 100 -> Plus
chr3L 11768197..11768396 178..377 99 -> Plus
chr3L 11767964..11768140 1..177 100 -> Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2009-10-19 17:51:25 Download gff for MIP04901.complete
Subject Subject Range Query Range Percent Splice Strand
CG14131-RA 1..2208 150..2357 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 13:52:18 Download gff for MIP04901.complete
Subject Subject Range Query Range Percent Splice Strand
CG14131-RA 1..2208 150..2357 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 04:56:39 Download gff for MIP04901.complete
Subject Subject Range Query Range Percent Splice Strand
CG14131-RA 1..2208 150..2357 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 22:42:40 Download gff for MIP04901.complete
Subject Subject Range Query Range Percent Splice Strand
CG14131-RA 1..2208 150..2357 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2009-04-30 10:00:47 Download gff for MIP04901.complete
Subject Subject Range Query Range Percent Splice Strand
CG14131-RA 1..2208 150..2357 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 13:52:18 Download gff for MIP04901.complete
Subject Subject Range Query Range Percent Splice Strand
CG14131-RA 1..2532 1..2532 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 04:56:39 Download gff for MIP04901.complete
Subject Subject Range Query Range Percent Splice Strand
CG14131-RA 1..2532 1..2532 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 22:42:40 Download gff for MIP04901.complete
Subject Subject Range Query Range Percent Splice Strand
CG14131-RA 1..2532 1..2532 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 22:42:40 Download gff for MIP04901.complete
Subject Subject Range Query Range Percent Splice Strand
3L 11778425..11780485 472..2532 100   Plus
3L 11778218..11778311 378..471 100 -> Plus
3L 11777306..11777505 178..377 100 -> Plus
3L 11777073..11777249 1..177 100 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 04:56:39 Download gff for MIP04901.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 11771525..11773585 472..2532 100   Plus
arm_3L 11771318..11771411 378..471 100 -> Plus
arm_3L 11770406..11770605 178..377 100 -> Plus
arm_3L 11770173..11770349 1..177 100 -> Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 11:43:06 Download gff for MIP04901.complete
Subject Subject Range Query Range Percent Splice Strand
3L 11771525..11773585 472..2532 100   Plus
3L 11771318..11771411 378..471 100 -> Plus
3L 11770406..11770605 178..377 100 -> Plus
3L 11770173..11770349 1..177 100 -> Plus

MIP04901.pep Sequence

Translation from 149 to 2356

> MIP04901.pep
MAQLKNVGQAGQQAVLVVGPMLASAMLLMGLIFALLGIKFFGFRRRLTFE
RSQVQRQQQNQQQQQPPPRYAAFESQVNGTDTAVHGVFRRRNLEEFESPW
PSASATTGNNFISGSVPNLQLYGASPRQPKSTEESPVSYREKSEAQRLEV
HSEHYEFYTAPPTRKPPSPPLQSEVLAETASVVSLPKILESIPAPPPRTM
RGAAASKPSGPAASVDTAPEPPSELGMPNFDHFAEKYELFSVKPTTAPTR
PTQLRSKNSGRYVKFEPVDDVPEILTPEDPVPELLTPDDGLGGAMSVTAV
VHRGAIPKEETESKDEPQAPNDTDPFGGPSNTDSAFVVEIIAGSPEAEAT
PSIQPTFQNGLFENLELPQGEHDSDFVRIRSSFVMNEADILDLDQLQLPA
ASSPPGFGKSIDEDWENFANLDAVVDVPEPNWSLHPNSLEQVPTVEATLN
EAAVRLDDVEQVEGLFHQLELIEPRMDIFEPEPPAPIINPPPYDPGLPYL
PDYESLMRLDIAKNGQKLPDYTEVMQQRSKTSNYVMSIEDLYADLDVNEV
EINGSQVNQSNEIPNFEALCQEMAVVVPSERQAPQPAPRSTKSARSLNVR
GSTSPLACYQPEELPSSSSSDTDGEEGARSAPEPAKRDPKSLKVRFDVDN
LQYYQSAEVVTSGDESEEDEPMQQPTPTQRSIIFEPSNTGVPSLFGSQVS
QEDSDDDNGFGRAISQHRSMTATLRTNAVRNNTDD*

MIP04901.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2014-11-28 09:34:45
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF25289-PA 716 GF25289-PA 1..715 1..734 2160 65.8 Plus
Blast to dere-all-translation-r1.3.fasta performed 2014-11-28 09:34:46
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG15529-PA 739 GG15529-PA 1..738 1..734 3031 87.5 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2014-11-28 09:34:48
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH15082-PA 713 GH15082-PA 1..696 1..725 1226 45.7 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 09:34:43
Subject Length Description Subject Range Query Range Score Percent Strand
CG14131-PA 735 CG14131-PA 1..735 1..735 3809 100 Plus
CG14131-PB 734 CG14131-PB 1..734 1..735 3793 99.9 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2014-11-28 09:34:50
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI13729-PA 736 GI13729-PA 1..719 1..725 1157 42.7 Plus
Blast to dper-all-translation-r1.3.fasta performed 2014-11-28 09:34:52
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL20719-PA 408 GL20719-PA 178..407 502..734 539 56.8 Plus
Dper\GL20719-PA 408 GL20719-PA 1..141 1..121 335 59 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2014-11-28 09:34:53
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA12781-PA 698 GA12781-PA 1..697 1..734 1563 53.7 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2014-11-28 09:34:55
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM25297-PA 736 GM25297-PA 1..735 1..734 3389 94.7 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2014-11-28 09:34:56
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD14328-PA 730 GD14328-PA 1..729 1..734 3236 93.8 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2014-11-28 09:34:58
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ14075-PA 717 GJ14075-PA 184..700 223..725 877 42.8 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2014-11-28 09:34:59
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK10500-PA 685 GK10500-PA 1..670 1..724 1189 44.7 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2014-11-28 09:35:01
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE21847-PA 736 GE21847-PA 1..735 1..734 3001 86.8 Plus

MIP04901.hyp Sequence

Translation from 149 to 2356

> MIP04901.hyp
MAQLKNVGQAGQQAVLVVGPMLASAMLLMGLIFALLGIKFFGFRRRLTFE
RSQVQRQQQNQQQQQPPPRYAAFESQVNGTDTAVHGVFRRRNLEEFESPW
PSASATTGNNFISGSVPNLQLYGASPRQPKSTEESPVSYREKSEAQRLEV
HSEHYEFYTAPPTRKPPSPPLQSEVLAETASVVSLPKILESIPAPPPRTM
RGAAASKPSGPAASVDTAPEPPSELGMPNFDHFAEKYELFSVKPTTAPTR
PTQLRSKNSGRYVKFEPVDDVPEILTPEDPVPELLTPDDGLGGAMSVTAV
VHRGAIPKEETESKDEPQAPNDTDPFGGPSNTDSAFVVEIIAGSPEAEAT
PSIQPTFQNGLFENLELPQGEHDSDFVRIRSSFVMNEADILDLDQLQLPA
ASSPPGFGKSIDEDWENFANLDAVVDVPEPNWSLHPNSLEQVPTVEATLN
EAAVRLDDVEQVEGLFHQLELIEPRMDIFEPEPPAPIINPPPYDPGLPYL
PDYESLMRLDIAKNGQKLPDYTEVMQQRSKTSNYVMSIEDLYADLDVNEV
EINGSQVNQSNEIPNFEALCQEMAVVVPSERQAPQPAPRSTKSARSLNVR
GSTSPLACYQPEELPSSSSSDTDGEEGARSAPEPAKRDPKSLKVRFDVDN
LQYYQSAEVVTSGDESEEDEPMQQPTPTQRSIIFEPSNTGVPSLFGSQVS
QEDSDDDNGFGRAISQHRSMTATLRTNAVRNNTDD*

MIP04901.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 14:45:28
Subject Length Description Subject Range Query Range Score Percent Strand
CG14131-PA 735 CG14131-PA 1..735 1..735 3809 100 Plus
CG14131-PB 734 CG14131-PB 1..734 1..735 3793 99.9 Plus