Clone MIP05131 Report

Search the DGRC for MIP05131

Clone and Library Details

Library:MIP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by:
Date Registered:2008-10-08
Comments:
Original Plate Number:51
Well:31
Vector:pOT2
Associated Gene/TranscriptCG31418-RA
Protein status:MIP05131.pep: gold
Sequenced Size:726

Clone Sequence Records

MIP05131.complete Sequence

726 bp assembled on 2009-04-09

GenBank Submission: BT082012.1

> MIP05131.complete
GAAAGTAGTAGGATGGAGGGGAATAGATCCCTTGTAGTGCTGGGCTTAAT
ACTAATTTTAATACAACTTACAACTCCAACTTCAACTCCAGCTCCAACTC
CACAGCCTGCTGGAGCCGAAGAAGCTCCAGGAAACAGTACTGCAGAGGCT
TCCAAATCCTCCACAGCGTCTAAGTGCAAGTCAACTGAAATTCTATCCGA
AAATGGCTGCGTGGATCGCGAAAACTTCCTCAACAAGATCGTGATGAGAT
CGTGGAGGGATGAAGGCTTTGAAAAGGCGAAGGCCAGAGCTGGCCTGGTC
GATGGCGTAGAGTGCAGGGATGGGGAGTTGAGGACTGCATTTGGCTGCTC
AAAGCCACTGTACCCACCGCACGTGGACGTAAACCGGGTGCCAGTTCACC
ACAGCAGACTAAATGGCGAACGGATTGTTCACGACAAGGGTATTTATAAA
CTCTATCACCACGTGGAAGATGTGGAACAAAAACCGATTCGAAAACCTAG
AGTGGTAGGACCTCCGATAACTGGAAACAAGCGCCCACGAAAGTACGTAT
TCTTGCCGGGAAGGAGTATTGGAAAGGGACACACATGTCGGGCTAATGAG
GTCCTGGGAAGAAGGAATCGCTGCATCCATAGGAAACGGTTAGCTGGCCA
ACGACAAAATCAAACAATCGAAAACGAACAGAGTCAATAAATTGTATTAC
TAGTATTATCAAAAAAAAAAAAAAAA

MIP05131.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 21:29:54
Subject Length Description Subject Range Query Range Score Percent Strand
CG31418-RA 721 CG31418-RA 8..721 1..714 3570 100 Plus
CG31419-RA 474 CG31419-RA 7..132 247..372 390 87.3 Plus
Blast to d_melanogaster_OreR.fa performed 2014-11-27 15:43:38
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 13108225..13108934 1..710 3490 99.4 Plus
chr3R 27901430 chr3R 13109264..13109499 172..407 625 84.3 Plus
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 15:43:35
Subject Length Description Subject Range Query Range Score Percent Strand
CG31418-RA 678 CG31418-PA 1..678 13..690 3390 100 Plus
CG31419-RB 717 CG31419-PB 175..410 172..407 625 84.3 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 20:04:30 has no hits.
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 15:43:34
Subject Length Description Subject Range Query Range Score Percent Strand
CG31418-RA 717 CG31418-RA 8..717 1..710 3550 100 Plus
CG31419-RB 774 CG31419-RB 194..429 172..407 625 84.3 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 15:43:37
Subject Length Description Subject Range Query Range Score Percent Strand
CG31418-PA 225 CG31418-PA 60..225 190..687 898 100 Plus
CG31419-PB 238 CG31419-PB 65..217 190..648 433 55.6 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 15:43:32
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 17283802..17284515 1..714 3570 100 Plus
3R 32079331 3R 17284841..17285076 172..407 625 84.3 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:46:19
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 17024633..17025346 1..714 3570 100 Plus
3R 31820162 3R 17025672..17025872 172..372 615 87 Plus
Blast to na_te.dros performed 2014-11-27 15:43:33
Subject Length Description Subject Range Query Range Score Percent Strand
mdg3 5519 mdg3 DMMDG3 5519bp Derived from X95908 (e990667) (Rel. 49, Last updated, Version 3). 3774..3816 657..699 107 72.1 Plus

MIP05131.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2014-11-27 16:35:49 Download gff for MIP05131.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 13108225..13108934 1..710 94   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2009-10-19 18:09:09 Download gff for MIP05131.complete
Subject Subject Range Query Range Percent Splice Strand
CG31418-RA 1..678 13..690 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 21:44:28 Download gff for MIP05131.complete
Subject Subject Range Query Range Percent Splice Strand
CG31418-RA 1..678 13..690 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 18:05:28 Download gff for MIP05131.complete
Subject Subject Range Query Range Percent Splice Strand
CG31418-RA 1..678 13..690 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 16:35:49 Download gff for MIP05131.complete
Subject Subject Range Query Range Percent Splice Strand
CG31418-RA 1..678 13..690 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2009-04-09 15:29:35 Download gff for MIP05131.complete
Subject Subject Range Query Range Percent Splice Strand
CG31418-RA 8..717 1..710 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 21:44:28 Download gff for MIP05131.complete
Subject Subject Range Query Range Percent Splice Strand
CG31418-RA 8..717 1..710 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 18:05:28 Download gff for MIP05131.complete
Subject Subject Range Query Range Percent Splice Strand
CG31418-RA 8..717 1..710 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 16:35:49 Download gff for MIP05131.complete
Subject Subject Range Query Range Percent Splice Strand
CG31418-RA 8..717 1..710 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 16:35:49 Download gff for MIP05131.complete
Subject Subject Range Query Range Percent Splice Strand
3R 17283802..17284511 1..710 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 18:05:28 Download gff for MIP05131.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 13109524..13110233 1..710 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 19:19:35 Download gff for MIP05131.complete
Subject Subject Range Query Range Percent Splice Strand
3R 17024633..17025342 1..710 100   Plus

MIP05131.pep Sequence

Translation from 0 to 689

> MIP05131.pep
ESSRMEGNRSLVVLGLILILIQLTTPTSTPAPTPQPAGAEEAPGNSTAEA
SKSSTASKCKSTEILSENGCVDRENFLNKIVMRSWRDEGFEKAKARAGLV
DGVECRDGELRTAFGCSKPLYPPHVDVNRVPVHHSRLNGERIVHDKGIYK
LYHHVEDVEQKPIRKPRVVGPPITGNKRPRKYVFLPGRSIGKGHTCRANE
VLGRRNRCIHRKRLAGQRQNQTIENEQSQ*

MIP05131.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2014-11-28 08:41:10
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF18141-PA 269 GF18141-PA 134..255 24..141 259 41 Plus
Dana\GF18141-PA 269 GF18141-PA 12..115 11..98 167 39.3 Plus
Blast to dere-all-translation-r1.3.fasta performed 2014-11-28 08:41:11
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG22126-PA 225 GG22126-PA 11..223 11..227 742 65.9 Plus
Dere\GG22137-PA 135 GG22137-PA 1..114 103..216 203 38.7 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 08:41:09
Subject Length Description Subject Range Query Range Score Percent Strand
CG31418-PA 225 CG31418-PA 1..225 5..229 1189 100 Plus
CG31419-PB 238 CG31419-PB 30..217 26..216 508 55 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2014-11-28 08:41:17
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA26634-PA 182 GA26634-PA 27..120 59..150 197 41.5 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2014-11-28 08:41:18
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM15220-PA 213 GM15220-PA 1..213 5..215 771 85 Plus
Dsec\GM15221-PA 157 GM15221-PA 1..142 81..222 333 47.9 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2014-11-28 08:41:19
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD19148-PA 227 GD19148-PA 1..227 5..229 832 85 Plus
Dsim\GD19149-PA 157 GD19149-PA 1..142 81..222 334 48.6 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2014-11-28 08:41:20
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ24426-PA 307 GJ24426-PA 103..290 35..211 295 37.8 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2014-11-28 08:41:21
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK11639-PA 264 GK11639-PA 49..225 56..217 274 38.8 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2014-11-28 08:41:22
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE10120-PA 228 GE10120-PA 9..226 13..229 735 64.7 Plus
Dyak\GE10121-PA 235 GE10121-PA 32..214 32..216 440 49.5 Plus
Dyak\GE10119-PA 109 GE10119-PA 10..99 13..101 228 53.8 Plus

MIP05131.hyp Sequence

Translation from 0 to 689

> MIP05131.hyp
ESSRMEGNRSLVVLGLILILIQLTTPTSTPAPTPQPAGAEEAPGNSTAEA
SKSSTASKCKSTEILSENGCVDRENFLNKIVMRSWRDEGFEKAKARAGLV
DGVECRDGELRTAFGCSKPLYPPHVDVNRVPVHHSRLNGERIVHDKGIYK
LYHHVEDVEQKPIRKPRVVGPPITGNKRPRKYVFLPGRSIGKGHTCRANE
VLGRRNRCIHRKRLAGQRQNQTIENEQSQ*

MIP05131.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:53:14
Subject Length Description Subject Range Query Range Score Percent Strand
CG31418-PA 225 CG31418-PA 1..225 5..229 1189 100 Plus
CG31419-PB 238 CG31419-PB 30..217 26..216 508 55 Plus