Clone MIP05134 Report

Search the DGRC for MIP05134

Clone and Library Details

Library:MIP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by:
Date Registered:2008-10-08
Comments:
Original Plate Number:51
Well:34
Vector:pOT2
Associated Gene/TranscriptCG31533-RA
Protein status:MIP05134.pep: gold
Sequenced Size:2711

Clone Sequence Records

MIP05134.complete Sequence

2711 bp assembled on 2009-04-28

GenBank Submission: BT082089.1

> MIP05134.complete
AACACACACACATAATTTGCGTTTCCAGTTCATATTTCTTTTTTAATCAC
CGATTTTAATAGATGATACCTCAGAAGAACTGACCTAGGACATACAAATT
CTAAAATACAGCAAATAAGCAACCAAAAAATGACGGAATCGGCTAACTTT
CTATTCGACTTGGTCATCACCAATCTGAATATTTTTGGCGTAACGATTGA
CGAACCCGCCAAACTCCTGGTGGAAACCAAGGTTGCCGGAAAATCAGTGA
AGGTAACGTCCAGCCGAATCAATGTCGACCAGTTTGTGGCCGGCAGGGAG
TTTGAGCTCCCAATGGAAGCATCGACATTGCGTCAAAGTCTGGAGGAGAA
GGGTTTGACTTTGGCGGGTGTTTACCAGGGATCAACTCTTGGCAAGGCCA
CGGGGAACTTCCCTGTGGAGTTTCTTGACAAGATCAGCCCCACGATGAAC
GATCTGGTGCACGAAGATACACTCGATTTGGTTCGTCGAGTTGATGTAGT
TGGAACGGTGAGCGTTCTAATCCGCTTGACCGTAAAGTGCGAGGAGCACC
CAGAGCAGAAGCCTTCAAGGCAAAGTCTTTCCCGAACCAGCAAATCATCG
ATGATACTACCGAAGAAAGAGAAAAGCGGACGAGTCAGTTGTGCTAGCCA
GGGCCCGACCTTCAATCCTCAGGATGTGATGTTTCTCATCGGCGATCCTG
ATCCTTTACTTCGAATTCCCTCGGAGCCGTGTTCTGAACTTCTATCCGAA
ATAGGAGATGAACGCCTGAAGCTGGACTTGCAGCGCTACAAAAGCTTGGA
AAATCGTCGAGCAATCTTTCCAGATGATGACCGCTGTCCCAAGCAAAAAC
CCTCATTTATGCAACTTAAAAAGCTCACCGAGGAGTATTCTAATATCATT
GACTCTGTGACCAAGAAGGTCAAAGAAATGGAACCGCAATCGAGCTCGTT
GGTTCCTACGGAGCCACCTTCCGATGCGAATGTCATAACTCCATTTTACA
CACCGCGGTCTCTAAGTCTTGCTCCCGTGAAATCTGGCATACCTGTTTCT
GTTAGATCCGACTTATTACATGGCGTGAAACCTATACGGTTCTGTCCTGT
CTGCTTGTGCTCCATGTCGTGGATGCCAAAATATGCACCATGCCCTCAAT
GCAATACTAAAGCAGTTCCCATACTCCAAGGACATCCGATCGAGAATATT
ACGGCAGAAGAAATTTTGGCTGAACAACTAGTAAAACCAAAAGCACCGCC
CGGAGTCGAGGACTTTTGTGAGCCACCATGCGAAAAGGTGCGCCGGAAGA
TCTGGAACGATACCGAGTGCCCACCATGCCGTTGTACATGCTCTAAGGGT
AATACCTGCCCCCACTGCCGAATCCGCAAGATGTGCGATGACATTTTTAC
CGCCAAGAGTCCACCAAAACCTCCCCGCCGAATTCCGAAGCCCCGGTCAA
GTGAGGATTTCTGTGTGGTCATGGAATCTGAGGGGGAAGATGATCTTCCC
TACCTGGCGAAGGTATTTTCCGAGCTAAAGAATCTGTACCATATCCACGA
CACCAAGAAGCTTTCAGCTATTAAGGAACGCTGCGCATCTCAGTCCTTGT
TCACTATCCGCAGCAGGCGATCCATCAAGGAGCTGACCAAATCGCTATAC
CCAGGAGACAAAATACTTGACGGAAGAAGCCATCATCCAAAGGCTGGCCA
CAAAAACTGCATTTCGTCCTCAAGCATTGTGTCTCGTCGCCATGGTTGGA
ACTGGACAAAAAGTTGCGAGGCACGGAAGAATGGCTGGCGGCCAGGTGCC
ATCCTACGATCCTCTGGCCATGTGATGCGTCACTTCCTGATGCGAAGTAG
AGATCCGAATATGTGCGGCAAGGTAACAGCTGATTACGAGGAACAGAAAC
GATTTGGCCATCCCGTGCTCAATATTTGCAAGCGAAATGGTAATATATTC
GTAACCCTTCGTCCACTGCCCACTTTGGGTATGAAACAGAAACCCATAAC
GTTCCGGATCGTCAAGAGCGATATGGCGGTGGCACTGCGCCAGATCAAGC
GTGCTCTCAAGGATCAGGGCTTCGAGAAGTGCAAGTGCCACCAGTCCCTG
ATGATGTGCACCTGTCGCGATGCCTTGGATAAATTTCACCTGAATAAGGC
TCTCAAGAAAGAGTGCCAGAAGCGTTTTATAGAGCCATGTCCCGACCACT
TGGTGCTTACCGACACAAGTGAGAGCGATTTGGAGTTCGATCTGGATGTG
ACTCCGCCGGCGGGAACTCGTAGACCGAAGCGCAAAGCCCTTAGGAACGT
GGTGAATCATAGCACCCAGACTGCAATGAAGGAGCCACCAGTTATACCGC
CTCCATATCCAGTAGCCCACAATCACTTCTATAGGGCCTACGATTGCGCA
GCAGGAGATCGGTATATGGGCACAGCCTTCGGCGATAATATAGAGACCGT
TTTCGAGGATGGAGTCTTTGGATACCGGGGTGGTGGCCAGCATGGAAAGC
CCGTAATCTGGCGACACCCGAAGGTGTGGGGCAAGAAGGCCCAGGCACCA
CTCCCGATTGGAACCGCTAGGAACGCCATCGATCCTTACCGGTATACCAA
AAATGTTTGGAAAGAACTGCCGCGAAAGATAATACAAAAAATGAGAGCAA
AATCAAGGAAATAATTGTATTCTTTTATTAAAAGTCAAAATGTAAAAAAA
AAAAAAAAAAA

MIP05134.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 16:22:40
Subject Length Description Subject Range Query Range Score Percent Strand
CG31533-RA 2704 CG31533-RA 12..2704 1..2693 13465 100 Plus
CG31327-RA 2623 CG31327-RA 1867..2141 1945..2219 565 80.3 Plus
CG31327-RA 2623 CG31327-RA 543..758 651..866 330 76.8 Plus
CG31327-RA 2623 CG31327-RA 2305..2421 2383..2499 300 83.7 Plus
CG14355-RA 3474 CG14355-RA 2136..2270 1975..2109 240 78.5 Plus
CG31327-RA 2623 CG31327-RA 2164..2244 2242..2322 165 80.2 Plus
Blast to d_melanogaster_OreR.fa performed 2014-11-27 08:43:16
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 9979578..9982267 2693..4 13315 99.7 Minus
chr3R 27901430 chr3R 9982610..9983164 2499..1945 900 77.5 Minus
chr3R 27901430 chr3R 9984273..9984488 866..651 315 76.4 Minus
chr3R 27901430 chr3R 9974439..9974573 2109..1975 240 78.5 Minus
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 08:43:11
Subject Length Description Subject Range Query Range Score Percent Strand
CG31533-RA 2535 CG31533-PA 1..2535 130..2664 12675 100 Plus
CG31327-RA 2586 CG31327-PA 1867..2421 1945..2499 885 77.3 Plus
CG31327-RA 2586 CG31327-PA 543..758 651..866 330 76.9 Plus
CG14355-RA 3075 CG14355-PA 1936..2070 1975..2109 240 78.5 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 20:04:31 has no hits.
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 08:43:09
Subject Length Description Subject Range Query Range Score Percent Strand
CG31533-RA 2704 CG31533-RA 12..2704 1..2693 13465 100 Plus
CG31327-RA 2719 CG31327-RA 1963..2517 1945..2499 885 77.3 Plus
CG31327-RA 2719 CG31327-RA 639..854 651..866 330 76.9 Plus
CG14355-RA 3292 CG14355-RA 2077..2211 1975..2109 240 78.5 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 08:43:14
Subject Length Description Subject Range Query Range Score Percent Strand
CG31533-PA 844 CG31533-PA 1..844 130..2661 4165 100 Plus
CG31327-PA 861 CG31327-PA 8..855 136..2643 2166 53 Plus
CG14355-PA 1024 CG14355-PA 36..835 148..2532 1457 41.5 Plus
CG31029-PA 905 CG31029-PA 318..802 1006..2283 410 29.3 Plus
Ppi1-PB 742 CG31025-PB 120..565 1087..2319 402 29.5 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 08:43:06
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 14154726..14157420 2695..1 13475 100 Minus
3R 32079331 3R 14157762..14158316 2499..1945 885 77.3 Minus
3R 32079331 3R 14159425..14159640 866..651 330 76.9 Minus
3R 32079331 3R 14149589..14149723 2109..1975 240 78.5 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 18:09:23
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 13895557..13898251 2695..1 13475 100 Minus
3R 31820162 3R 13898873..13899147 2219..1945 565 80.3 Minus
3R 31820162 3R 13900256..13900471 866..651 330 76.8 Minus
3R 31820162 3R 13898593..13898709 2499..2383 300 83.7 Minus
3R 31820162 3R 13890420..13890554 2109..1975 240 78.5 Minus
3R 31820162 3R 13898770..13898850 2322..2242 165 80.2 Minus
Blast to na_te.dros performed on 2014-11-27 08:43:07 has no hits.

MIP05134.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2014-11-27 10:14:33 Download gff for MIP05134.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 9979578..9982268 1..2693 99   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2009-10-19 17:51:09 Download gff for MIP05134.complete
Subject Subject Range Query Range Percent Splice Strand
CG31533-RA 1..2535 130..2664 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 13:46:36 Download gff for MIP05134.complete
Subject Subject Range Query Range Percent Splice Strand
CG31533-RA 1..2535 130..2664 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 10:49:06 Download gff for MIP05134.complete
Subject Subject Range Query Range Percent Splice Strand
CG31533-RA 1..2535 130..2664 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 10:14:33 Download gff for MIP05134.complete
Subject Subject Range Query Range Percent Splice Strand
CG31533-RA 1..2535 130..2664 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2009-04-28 17:10:06 Download gff for MIP05134.complete
Subject Subject Range Query Range Percent Splice Strand
CG31533-RA 1..2535 130..2664 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 13:46:36 Download gff for MIP05134.complete
Subject Subject Range Query Range Percent Splice Strand
CG31533-RA 12..2704 1..2693 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 10:49:06 Download gff for MIP05134.complete
Subject Subject Range Query Range Percent Splice Strand
CG31533-RA 12..2704 1..2693 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 10:14:33 Download gff for MIP05134.complete
Subject Subject Range Query Range Percent Splice Strand
CG31533-RA 12..2704 1..2693 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 10:14:33 Download gff for MIP05134.complete
Subject Subject Range Query Range Percent Splice Strand
3R 14154728..14157420 1..2693 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 10:49:06 Download gff for MIP05134.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 9980450..9983142 1..2693 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 11:32:25 Download gff for MIP05134.complete
Subject Subject Range Query Range Percent Splice Strand
3R 13895559..13898251 1..2693 100   Minus

MIP05134.pep Sequence

Translation from 129 to 2663

> MIP05134.pep
MTESANFLFDLVITNLNIFGVTIDEPAKLLVETKVAGKSVKVTSSRINVD
QFVAGREFELPMEASTLRQSLEEKGLTLAGVYQGSTLGKATGNFPVEFLD
KISPTMNDLVHEDTLDLVRRVDVVGTVSVLIRLTVKCEEHPEQKPSRQSL
SRTSKSSMILPKKEKSGRVSCASQGPTFNPQDVMFLIGDPDPLLRIPSEP
CSELLSEIGDERLKLDLQRYKSLENRRAIFPDDDRCPKQKPSFMQLKKLT
EEYSNIIDSVTKKVKEMEPQSSSLVPTEPPSDANVITPFYTPRSLSLAPV
KSGIPVSVRSDLLHGVKPIRFCPVCLCSMSWMPKYAPCPQCNTKAVPILQ
GHPIENITAEEILAEQLVKPKAPPGVEDFCEPPCEKVRRKIWNDTECPPC
RCTCSKGNTCPHCRIRKMCDDIFTAKSPPKPPRRIPKPRSSEDFCVVMES
EGEDDLPYLAKVFSELKNLYHIHDTKKLSAIKERCASQSLFTIRSRRSIK
ELTKSLYPGDKILDGRSHHPKAGHKNCISSSSIVSRRHGWNWTKSCEARK
NGWRPGAILRSSGHVMRHFLMRSRDPNMCGKVTADYEEQKRFGHPVLNIC
KRNGNIFVTLRPLPTLGMKQKPITFRIVKSDMAVALRQIKRALKDQGFEK
CKCHQSLMMCTCRDALDKFHLNKALKKECQKRFIEPCPDHLVLTDTSESD
LEFDLDVTPPAGTRRPKRKALRNVVNHSTQTAMKEPPVIPPPYPVAHNHF
YRAYDCAAGDRYMGTAFGDNIETVFEDGVFGYRGGGQHGKPVIWRHPKVW
GKKAQAPLPIGTARNAIDPYRYTKNVWKELPRKIIQKMRAKSRK*

MIP05134.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2014-11-28 06:59:50
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF18781-PA 963 GF18781-PA 6..817 3..816 1976 50.3 Plus
Dana\GF18780-PA 1039 GF18780-PA 145..934 41..816 1974 51.8 Plus
Dana\GF18782-PA 914 GF18782-PA 6..788 3..789 1925 49.4 Plus
Dana\GF18784-PA 1013 GF18784-PA 27..839 6..801 1451 40.2 Plus
Dana\GF16202-PA 919 GF16202-PA 320..848 303..761 399 26.5 Plus
Dana\GF18780-PA 1039 GF18780-PA 11..141 7..137 209 30.5 Plus
Blast to dere-all-translation-r1.3.fasta performed 2014-11-28 06:59:52
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG21443-PA 844 GG21443-PA 1..844 1..844 3797 85.9 Plus
Dere\GG21437-PA 861 GG21437-PA 8..860 3..843 2228 51.4 Plus
Dere\GG21461-PA 1027 GG21461-PA 36..819 7..789 1450 41.5 Plus
Dere\GG11963-PA 909 GG11963-PA 336..848 317..761 436 27.8 Plus
Dere\GG11964-PA 995 GG11964-PA 373..848 320..761 409 29.8 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2014-11-28 06:59:53
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH19688-PA 859 GH19688-PA 11..764 6..801 1425 40.5 Plus
Dgri\GH23716-PA 859 GH23716-PA 11..764 6..801 1417 40.9 Plus
Dgri\GH23723-PA 944 GH23723-PA 2..775 3..777 1245 36.7 Plus
Dgri\GH19689-PA 944 GH19689-PA 2..775 3..777 1244 36.8 Plus
Dgri\GH19690-PA 905 GH19690-PA 6..788 4..808 1206 36 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 06:59:48
Subject Length Description Subject Range Query Range Score Percent Strand
CG31533-PA 844 CG31533-PA 1..844 1..844 4507 100 Plus
CG31327-PA 861 CG31327-PA 8..855 3..838 2341 53.5 Plus
CG14355-PA 1024 CG14355-PA 36..835 7..801 1570 41.6 Plus
CG31029-PA 905 CG31029-PA 318..892 293..822 444 28.5 Plus
Ppi1-PB 742 CG31025-PB 120..595 320..761 424 29.9 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2014-11-28 06:59:55
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI24545-PA 963 GI24545-PA 10..784 6..808 1495 41 Plus
Dmoj\GI24547-PA 991 GI24547-PA 2..768 3..777 1193 37.8 Plus
Dmoj\GI24548-PA 1434 GI24548-PA 565..1357 21..811 1154 35.2 Plus
Dmoj\GI24549-PA 1916 GI24549-PA 3..789 2..788 1082 34.7 Plus
Dmoj\GI24549-PA 1916 GI24549-PA 961..1734 12..801 901 29.6 Plus
Dmoj\GI24548-PA 1434 GI24548-PA 70..541 316..789 882 41.4 Plus
Dmoj\GI24546-PA 492 GI24546-PA 2..474 3..477 550 30.1 Plus
Blast to dper-all-translation-r1.3.fasta performed 2014-11-28 06:59:56
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL23302-PA 818 GL23302-PA 2..811 4..839 1741 43 Plus
Dper\GL23303-PA 893 GL23303-PA 43..891 7..843 1682 42.3 Plus
Dper\GL23304-PA 1041 GL23304-PA 35..852 6..794 1486 41.2 Plus
Dper\GL14071-PA 997 GL14071-PA 98..875 7..761 520 26.8 Plus
Dper\GL14070-PA 916 GL14070-PA 328..836 321..761 362 27 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2014-11-28 06:59:58
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA16184-PA 819 GA16184-PA 2..816 4..843 1747 42.9 Plus
Dpse\GA27215-PA 893 GA27215-PA 43..891 7..843 1663 42 Plus
Dpse\GA27216-PA 1074 GA27216-PA 35..852 6..794 1493 41.4 Plus
Dpse\GA15947-PB 981 GA15947-PB 98..859 7..761 516 26.7 Plus
Dpse\GA15947-PC 723 GA15947-PC 121..601 320..761 461 30.7 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2014-11-28 07:00:00
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM25876-PA 844 GM25876-PA 1..844 1..844 4079 94.2 Plus
Dsec\GM25875-PA 752 GM25875-PA 1..746 106..838 2050 54.7 Plus
Dsec\GM25881-PA 1022 GM25881-PA 36..810 7..780 1484 41.7 Plus
Dsec\GM12182-PA 992 GM12182-PA 492..845 459..761 389 33.1 Plus
Dsec\GM12180-PA 571 GM12180-PA 228..501 513..761 287 31.1 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2014-11-28 07:00:02
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD20447-PA 844 GD20447-PA 1..844 1..844 4092 94.5 Plus
Dsim\GD20446-PA 861 GD20446-PA 7..855 2..838 2304 53.5 Plus
Dsim\GD20450-PA 1022 GD20450-PA 36..810 7..780 1478 41.6 Plus
Dsim\GD17333-PA 918 GD17333-PA 334..848 315..761 384 27.6 Plus
Dsim\GD17344-PA 998 GD17344-PA 498..851 459..761 379 32.7 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2014-11-28 07:00:03
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ22612-PA 882 GJ22612-PA 2..693 39..777 1325 40.9 Plus
Dvir\GJ22613-PA 934 GJ22613-PA 2..766 4..777 1303 37.5 Plus
Dvir\GJ22615-PA 851 GJ22615-PA 7..737 82..818 1171 38.6 Plus
Dvir\GJ22614-PA 634 GJ22614-PA 146..446 522..818 705 47.2 Plus
Dvir\GJ10379-PA 932 GJ10379-PA 348..821 315..761 406 28.8 Plus
Dvir\GJ22614-PA 634 GJ22614-PA 5..150 6..153 233 32.4 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2014-11-28 07:00:04
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK10902-PA 813 GK10902-PA 3..813 4..844 1694 44.6 Plus
Dwil\GK10904-PA 1042 GK10904-PA 19..834 1..804 1591 42.3 Plus
Dwil\GK10903-PA 729 GK10903-PA 1..700 42..762 1242 39.9 Plus
Dwil\GK13152-PA 923 GK13152-PA 317..822 321..761 428 27.6 Plus
Dwil\GK13153-PA 981 GK13153-PA 528..872 459..761 382 30.3 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2014-11-28 07:00:06
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE10053-PA 847 GE10053-PA 1..847 1..844 3806 83.2 Plus
Dyak\GE10052-PA 860 GE10052-PA 8..859 3..843 2251 52.4 Plus
Dyak\GE10056-PA 1028 GE10056-PA 36..819 7..789 1456 42.2 Plus
Dyak\GE23413-PA 912 GE23413-PA 336..851 317..761 437 28.7 Plus
Dyak\GE23414-PA 1000 GE23414-PA 377..853 320..761 419 31 Plus

MIP05134.hyp Sequence

Translation from 129 to 2663

> MIP05134.hyp
MTESANFLFDLVITNLNIFGVTIDEPAKLLVETKVAGKSVKVTSSRINVD
QFVAGREFELPMEASTLRQSLEEKGLTLAGVYQGSTLGKATGNFPVEFLD
KISPTMNDLVHEDTLDLVRRVDVVGTVSVLIRLTVKCEEHPEQKPSRQSL
SRTSKSSMILPKKEKSGRVSCASQGPTFNPQDVMFLIGDPDPLLRIPSEP
CSELLSEIGDERLKLDLQRYKSLENRRAIFPDDDRCPKQKPSFMQLKKLT
EEYSNIIDSVTKKVKEMEPQSSSLVPTEPPSDANVITPFYTPRSLSLAPV
KSGIPVSVRSDLLHGVKPIRFCPVCLCSMSWMPKYAPCPQCNTKAVPILQ
GHPIENITAEEILAEQLVKPKAPPGVEDFCEPPCEKVRRKIWNDTECPPC
RCTCSKGNTCPHCRIRKMCDDIFTAKSPPKPPRRIPKPRSSEDFCVVMES
EGEDDLPYLAKVFSELKNLYHIHDTKKLSAIKERCASQSLFTIRSRRSIK
ELTKSLYPGDKILDGRSHHPKAGHKNCISSSSIVSRRHGWNWTKSCEARK
NGWRPGAILRSSGHVMRHFLMRSRDPNMCGKVTADYEEQKRFGHPVLNIC
KRNGNIFVTLRPLPTLGMKQKPITFRIVKSDMAVALRQIKRALKDQGFEK
CKCHQSLMMCTCRDALDKFHLNKALKKECQKRFIEPCPDHLVLTDTSESD
LEFDLDVTPPAGTRRPKRKALRNVVNHSTQTAMKEPPVIPPPYPVAHNHF
YRAYDCAAGDRYMGTAFGDNIETVFEDGVFGYRGGGQHGKPVIWRHPKVW
GKKAQAPLPIGTARNAIDPYRYTKNVWKELPRKIIQKMRAKSRK*

MIP05134.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 15:14:00
Subject Length Description Subject Range Query Range Score Percent Strand
CG31533-PA 844 CG31533-PA 1..844 1..844 4507 100 Plus
CG31327-PA 861 CG31327-PA 8..855 3..838 2341 53.5 Plus
CG14355-PA 1024 CG14355-PA 36..835 7..801 1570 41.6 Plus
CG31029-PA 905 CG31029-PA 318..892 293..822 444 28.5 Plus
Ppi1-PB 742 CG31025-PB 120..595 320..761 424 29.9 Plus