Clone MIP05153 Report

Search the DGRC for MIP05153

Clone and Library Details

Library:MIP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by:
Date Registered:2008-10-08
Comments:
Original Plate Number:51
Well:53
Vector:pOT2
Associated Gene/TranscriptCG31867-RA
Protein status:MIP05153.pep: gold
Sequenced Size:853

Clone Sequence Records

MIP05153.complete Sequence

853 bp assembled on 2009-09-15

GenBank Submission: BT099763.1

> MIP05153.complete
CCTGTCTGCCTTGATTTCCTTAGAAATTCAAAATTAATCGTTTTTTTTTG
CGTTTTAATAATGCGTGATTATGCGTCCAACGTGATACGTTCGCATCGCT
GCCTTTGCATTTTTACGGTGCTCCAATTGACCCTAATGCTCTCGATGCTG
GAAGTTCAAATCCAAATTGACCAATCGCCGGAGCTCCAGCGACCTATGAC
CCGAGTGCTTTTGGGGGCCCAACTAGGGGAGCTTGCCTGGAGTCCATTGT
TTTCCGGTTTTGCCATGGGTGCCATGTTCTACGGCTATGGTTTGATACAC
CTGCCCAGCAAAGGACCCCTCGGGTGCTTCTTCTCCAGGCTGCGAACAGC
TGGCTTGTCCGTGTGGCAACAATGTAGTCCCGTGATGCTTGTGCCCTGGA
CCTTGAAGGTGGCCCAGGGCCTAAGCCTATTCCCTTGCCATTTGTGGGAG
TTTCTTGCGAATGAGGTGTGCTTAGAGACCGACAATTGTCTGCAGCACGT
CATTCTGGCTTTTGTACTGTGGATATACCTGCTAATCCTGGCCATCACTA
GCTTGGTCTCTGTTGTGAGACTCAATCTTCAGATGCTGGCTGACAGGCAC
ATTCACAGCAGAGACCACGAGCTGCGGGCCTATGTACGGGGAATCAATGA
ACTTCTCGGATTTGAGATGATAATGGTCACCGAATGAGAGGTTTGGGGTA
CCTACAAGCATTTTCCATAAATTAAACCTCTATTGTATGGGACAGTATTA
GAACATAACAAATTGGAAATTGTTTTTATTTGATAGAAGCAATGTTATCG
TGTACATTTTATAAATGCAGTAAACGAAATTTTAATCAAAAAAAAAAAAA
AAA

MIP05153.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 21:29:59
Subject Length Description Subject Range Query Range Score Percent Strand
CG31867-RA 839 CG31867-RA 3..839 1..837 4185 100 Plus
Blast to d_melanogaster_OreR.fa performed 2014-11-26 20:41:55
Subject Length Description Subject Range Query Range Score Percent Strand
chr2L 23010047 chr2L 11143308..11144132 837..1 3665 96.3 Minus
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 20:41:51
Subject Length Description Subject Range Query Range Score Percent Strand
CG31867-RB 627 CG31867-PB 1..627 61..687 3135 100 Plus
CG31867-RA 627 CG31867-PA 1..627 61..687 3135 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 20:04:33 has no hits.
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 20:41:50
Subject Length Description Subject Range Query Range Score Percent Strand
CG31867-RA 839 CG31867-RA 3..839 1..837 4185 100 Plus
CG31867-RB 701 CG31867-RB 3..701 1..699 3495 100 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-26 20:41:53
Subject Length Description Subject Range Query Range Score Percent Strand
CG31867-PB 208 CG31867-PB 1..208 61..684 1086 100 Plus
CG31867-PA 208 CG31867-PA 1..208 61..684 1086 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 20:41:47
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 11144577..11145415 839..1 4195 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:46:33
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 11144577..11145415 839..1 4195 100 Minus
Blast to na_te.dros performed on 2014-11-26 20:41:48 has no hits.

MIP05153.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2014-11-26 21:43:54 Download gff for MIP05153.complete
Subject Subject Range Query Range Percent Splice Strand
chr2L 11143434..11144132 1..696 98   Minus
chr2L 11143308..11143433 712..837 97 == Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2009-10-19 17:54:31 Download gff for MIP05153.complete
Subject Subject Range Query Range Percent Splice Strand
CG31867-RA 1..627 61..687 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 21:44:51 Download gff for MIP05153.complete
Subject Subject Range Query Range Percent Splice Strand
CG31867-RA 1..627 61..687 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 02:19:38 Download gff for MIP05153.complete
Subject Subject Range Query Range Percent Splice Strand
CG31867-RA 1..627 61..687 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 21:43:54 Download gff for MIP05153.complete
Subject Subject Range Query Range Percent Splice Strand
CG31867-RA 1..627 61..687 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2009-09-15 17:42:40 Download gff for MIP05153.complete
Subject Subject Range Query Range Percent Splice Strand
CG31867-RA 3..839 1..837 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 21:44:51 Download gff for MIP05153.complete
Subject Subject Range Query Range Percent Splice Strand
CG31867-RA 3..839 1..837 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 02:19:38 Download gff for MIP05153.complete
Subject Subject Range Query Range Percent Splice Strand
CG31867-RA 3..839 1..837 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 21:43:54 Download gff for MIP05153.complete
Subject Subject Range Query Range Percent Splice Strand
CG31867-RA 3..839 1..837 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 21:43:54 Download gff for MIP05153.complete
Subject Subject Range Query Range Percent Splice Strand
2L 11144579..11145415 1..837 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 02:19:38 Download gff for MIP05153.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 11144579..11145415 1..837 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 19:20:02 Download gff for MIP05153.complete
Subject Subject Range Query Range Percent Splice Strand
2L 11144579..11145415 1..837 100   Minus

MIP05153.pep Sequence

Translation from 0 to 686

> MIP05153.pep
PVCLDFLRNSKLIVFFCVLIMRDYASNVIRSHRCLCIFTVLQLTLMLSML
EVQIQIDQSPELQRPMTRVLLGAQLGELAWSPLFSGFAMGAMFYGYGLIH
LPSKGPLGCFFSRLRTAGLSVWQQCSPVMLVPWTLKVAQGLSLFPCHLWE
FLANEVCLETDNCLQHVILAFVLWIYLLILAITSLVSVVRLNLQMLADRH
IHSRDHELRAYVRGINELLGFEMIMVTE*

MIP05153.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 08:42:20
Subject Length Description Subject Range Query Range Score Percent Strand
CG31867-PB 208 CG31867-PB 1..208 21..228 1086 100 Plus
CG31867-PA 208 CG31867-PA 1..208 21..228 1086 100 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2014-11-28 08:42:28
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA25708-PA 202 GA25708-PA 9..200 35..226 287 33.7 Plus

MIP05153.hyp Sequence

Translation from 0 to 686

> MIP05153.hyp
PVCLDFLRNSKLIVFFCVLIMRDYASNVIRSHRCLCIFTVLQLTLMLSML
EVQIQIDQSPELQRPMTRVLLGAQLGELAWSPLFSGFAMGAMFYGYGLIH
LPSKGPLGCFFSRLRTAGLSVWQQCSPVMLVPWTLKVAQGLSLFPCHLWE
FLANEVCLETDNCLQHVILAFVLWIYLLILAITSLVSVVRLNLQMLADRH
IHSRDHELRAYVRGINELLGFEMIMVTE*

MIP05153.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:18:34
Subject Length Description Subject Range Query Range Score Percent Strand
CG31867-PB 208 CG31867-PB 1..208 21..228 1086 100 Plus
CG31867-PA 208 CG31867-PA 1..208 21..228 1086 100 Plus