Clone MIP05212 Report

Search the DGRC for MIP05212

Clone and Library Details

Library:MIP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by:
Date Registered:2008-10-08
Comments:
Original Plate Number:52
Well:12
Vector:pOT2
Associated Gene/TranscriptCG30480-RA
Protein status:MIP05212.pep: gold
Sequenced Size:3466

Clone Sequence Records

MIP05212.complete Sequence

3466 bp assembled on 2009-06-19

GenBank Submission: BT088840.1

> MIP05212.complete
AAGACGAGACGGCATAATTATCGACAAAATGAAAACGACAATCGTGGAGG
AGAGGAGTGTGAATGAAACGATAGAAACAATAGCCACGAGCAGTGGCTCC
GTCCAGGAGACAATCGAGATCGTGAATATCGATGGATCTGTAGCACCAAA
GCATCGTCACCATCATCACCATCACAGACATCATCATCACCATGAAAGGC
AGGAAAATGTTGAAGTTGTGGCAACAGAGGAAGTGATTCTTGTGGAGAAC
GCACCGAAATCGAGGAAGCATCACCACCACAAGCAGAGGACTTCTCCACC
ACCGCCCCTGCCGCAAACCTCACCACCATTCCTCACCCCCACTGAAGAAG
TGGGTTTCAATGTGGTGTGGGAACCCCAGGCCTTTTGGAACCAGCCCTCA
CCCAATCCCTCCACTGATCTAGATCTCTCACAGGATAACGAGGTTGTCGA
TGCAGTGGAGACTATGGACACTACTTCAGCTTCCGATGAATTCACCACTG
TTGTTTTTCAATCAGAGACAAAGGAGTCTATTAGGGAAACACAGAAGCAC
ACTAGAGTGGTGGAGGAGGAAATAATAATTGATCAATTGGACCCACCACC
CTATGCACCACCGCCACTTCAAGTGCAGACAGGATTCTTTCCAGTGGCTC
AGCAGCCCCCACTTTCACCCATCGCAGAAGTGGTGCAAACAGATGTGGTG
GCGGAATCGGTGGAACCTCCACTACCGCCTACAGGTTATATTCCCAGAAT
AAATCTAAAGCCAACGGAAACTATTGTCGAGAATGTCGAGGTCATCGTGC
CCGCACAAATTCAACAAGAGCCGGAGTTTATTCCGCAGCCGGGATTTGTG
GCCAGAATTGTGGAGAACATAGAAGTTGCCGCAGCATCTAAGTCATCACT
GGTTTCACCTCAAAAGAGTTATTATCCTCGGACAGGCATGGTGGAGACGA
TTGTGGAAGATATTGAAGTGGTAAAAGATGATGCTCCTGTTCAGAGTGGT
TATATTCCCGGAAATGTTGAAGTGGAATCGATTGTGGAAAATATAGATGC
CGATTCTCCCTTTCTTCTTCCACCCAATGGATTCGCTACTGATGAGTCCA
TTGTGGAAAACATTGAAGTCTCGACAGATGTAGATGATTCTCCATTTCTG
CTTCCAGTTAATGGCTTTGACTCTGAACCAGTCTGTGTGGAATCGATTGT
TGAAAATATAGAAGTTACACCTTCTCAACCTGTCCTGCAAATATCAGATC
AAAGTGTTGTTCCTGCAGGCTTTGTCGAGTCTGCGGTGGAAGACATACAA
GTCATAGAAACGGAAGATCCCCCATTCCTACTGCCGACTGAAAATGACTT
TACTGCTCAGGCAGGCAATGTGGAATCCCTGATAGAAAATATAGAAGTAA
CTACGGAGGTGGATCTCACATTAAGACAATCAGAACAAATAGAAAATCTA
CCTCGATCTGGTTTCGTGGAATCCATTGTAGAAAACATTGAAGTCACTCA
AGAAGTAGATCCCCCACAGCCTGCAGTTCCAAGTGATGTGGTCACTCAGA
GTGGTCTAGTAGAATCGATAGTGGAAAACATCGAAGTCACAGAAATAGTG
GATATACAAGCTCCGGCTCCACCACAAACTGGATTTGTGGAATCGGTAGT
GGAACGTTTAGATGTCACGGAAGAAGTTGAACCTTCAGTGCGACCACCAC
TTCCACTTAGCTATCCTCCTCGTTCAGGGTTCGTAGAATCTATCGTGGAG
AATATAGAAGTAGAACAAGTTACTCCTTCTTATCAACCTCCCCAGCAAAT
TGTTCCTCAATCAGGTTTTGTAGAAACATTTGTAGAGGATATTGAAATCA
AAGAATCTGCGCTACCGCCAATTCAAAATGGATATGCACCCCAAGCAGGA
GTAGTTGAAACAATTGTCGAAGAAGTAGAAATCGTACCCGATCCTCCACG
TCAATCCATAGTGACAACCGATTATATGCCCCGTGCAAGTTTGGTTCAAG
AACTGGTTGTGGAATCACTTGAGGTCACACCAACATCATCGCCTCCACCC
GAACAGTTTCCCTTCATTTCCAGAGAGAGCCTAATCGTAGCTGATGATTA
CGTGGAGGTGGAAGAAGTCACCCCTTACAATACGGCACCACATAGTCCAA
TAGTGGAAGTGGAAAGATTGAGTGAAGCCGAGTCTTATGTGGAGATTAAT
GAAGTTGCACCAGTTAATACTCCACCCCAGAGGTCCGTTGAAGTGGGTTT
CCTTCCCAGACCCAGCTTAGCCGAAACGGCGGTGGTTGTGGAATCAGTGG
AGGTAACTCCAACTCCAACACCGCCACCAAGCCCAGCACTGAAACTCAAA
ATACCACCGTCGAATCAGATACCATCGGAGGTGATTGTGGACCAACCAGT
TCCATCTTCAACTTTCAAGCCACCAGCGAAGCCACTTAACAATTTCATTC
TAACTGATCTGGTCATCGACGATCCTCCATTCGTAGAAGTGGTGGAAAGG
GAAGTGGTTGTTGAGTCCGCAAACAATGGCCAAGTCACTGAGGTTATCGA
AGTCACGGAAGAGATCATACAACCCGTCACACCCATCGGAACTGTTTTGG
TGGGGGAGGTATCCGAGCAAAACAGCGACAAATTTGGCAAGCGATATTCC
CTAAGTGCGACACTGGCTGATGGACAGCAGCAGGTGCAGGGAAAACCGGA
AACGAATCAGTCACCACCGATCCAAAAACGAGATAAACCCACCGAACCAC
CGAAGCGTAGATGTTGCCAGTGTAAATGCATCATTTCCTAAAGCAGAGGT
CAGGGGCTTTCCCCAAGCCTGGGAATGTAAGCTCCACCTATCGCATATCT
AATCAGGTAAAACAGAAGACCCTCCAAAAAAAAAAAATCACAGTAATTGA
TAGTTAATTACCGGCGGACACTCGAGGAAATAGCGTAGATAAGTGGCAAA
CTCAAGAACCCCAATCGACCCGAAAGTGCTGGTCAGTCAGTCAGTCAGTA
GTTAGCCATCGGTCGAGATGCCACCCCCAGGACGCGGATACGGAGGACCA
CCTCCACGGGGTCCCGGAATCGCCTACGGACCACCGCCACCTCGAGTGAA
TGTCGGCATCAATATCGGCGGACCACCGCGTCCGCCGCCCATAGGCGTGG
GCATCGGCTTTGCTCCGCCACCCGTGGTGGTTGCACCACCGCCACCAACT
GTGATCGTCGGAGCACCACCACCACCGCCCATGGTCGTGATGCCGCCGCC
ACGGCCCACCGTTGTGGTGGGTGGCCAGGCTCCGGTGGCCAGTGTGTATG
CCCAGCCGCAAGGAGAGGTTTTCTGCTGCACTATTCTCTGACGAAAAATA
GGAAATGAAAAACTGTGCTTCTGTATAGAATTATTCACTACGTGTACATA
TATGCCTTAAATAAGTAAAATAAAATAGTTAACTCATAGTAAAAAAAAAA
AAAAAAAAAAAAAAAA

MIP05212.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 21:32:14
Subject Length Description Subject Range Query Range Score Percent Strand
CG30480-RA 2963 CG30480-RA 18..2834 1..2817 14085 100 Plus
CG30479-RA 589 CG30479-RA 1..451 2993..3443 2255 100 Plus
CG30480-RA 2963 CG30480-RA 2904..2963 2816..2875 300 100 Plus
Blast to d_melanogaster_OreR.fa performed 2014-11-27 08:38:47
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 10562597..10565416 2817..1 13780 99.3 Minus
chr2R 21145070 chr2R 10561903..10562527 3440..2816 3095 99.7 Minus
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 08:38:42
Subject Length Description Subject Range Query Range Score Percent Strand
CG30480-RB 2763 CG30480-PB 1..2763 29..2791 13815 100 Plus
CG30480-RA 2763 CG30480-PA 1..2763 29..2791 13815 100 Plus
CG30479-RB 324 CG30479-PB 1..324 3018..3341 1620 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 20:04:36 has no hits.
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 08:38:41
Subject Length Description Subject Range Query Range Score Percent Strand
CG30480-RB 3460 CG30480-RB 21..3460 1..3440 17200 100 Plus
CG30479-RB 3460 CG30479-RB 21..3460 1..3440 17200 100 Plus
CG30480-RA 2966 CG30480-RA 21..2837 1..2817 14085 100 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 08:38:45
Subject Length Description Subject Range Query Range Score Percent Strand
CG30480-PB 920 CG30480-PB 1..920 29..2788 3759 100 Plus
CG30480-PA 920 CG30480-PA 1..920 29..2788 3759 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 08:38:39
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 14675300..14678116 2817..1 14085 100 Minus
2R 25286936 2R 14674603..14675230 3443..2816 3140 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:48:36
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 14676499..14679315 2817..1 14085 100 Minus
2R 25260384 2R 14675802..14676429 3443..2816 3140 100 Minus
Blast to na_te.dros performed on 2014-11-27 08:38:39 has no hits.

MIP05212.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2014-11-27 10:29:49 Download gff for MIP05212.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 10562597..10565416 1..2817 99   Minus
chr2R 10561903..10562525 2818..3440 99 <- Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2009-10-19 18:10:46 Download gff for MIP05212.complete
Subject Subject Range Query Range Percent Splice Strand
CG30480-RA 1..2763 29..2791 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 21:48:18 Download gff for MIP05212.complete
Subject Subject Range Query Range Percent Splice Strand
CG30480-RA 1..2763 29..2791 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 14:11:44 Download gff for MIP05212.complete
Subject Subject Range Query Range Percent Splice Strand
CG30480-RA 1..2763 29..2791 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 10:29:49 Download gff for MIP05212.complete
Subject Subject Range Query Range Percent Splice Strand
CG30480-RA 1..2763 29..2791 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2009-06-19 11:46:37 Download gff for MIP05212.complete
Subject Subject Range Query Range Percent Splice Strand
CG30480-RA 18..2834 1..2817 100 -> Plus
CG30480-RA 2906..2963 2818..2875 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 21:48:18 Download gff for MIP05212.complete
Subject Subject Range Query Range Percent Splice Strand
CG30480-RA 2906..2963 2818..2875 100   Plus
CG30480-RA 18..2834 1..2817 100 -> Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 14:11:44 Download gff for MIP05212.complete
Subject Subject Range Query Range Percent Splice Strand
CG30480-RB 21..3460 1..3440 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 10:29:49 Download gff for MIP05212.complete
Subject Subject Range Query Range Percent Splice Strand
CG30479-RB 21..3460 1..3440 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 10:29:49 Download gff for MIP05212.complete
Subject Subject Range Query Range Percent Splice Strand
2R 14675300..14678116 1..2817 100   Minus
2R 14674606..14675228 2818..3440 100 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 14:11:44 Download gff for MIP05212.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 10562805..10565621 1..2817 100   Minus
arm_2R 10562111..10562733 2818..3440 100 <- Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 19:23:53 Download gff for MIP05212.complete
Subject Subject Range Query Range Percent Splice Strand
2R 14676499..14679315 1..2817 100   Minus
2R 14675805..14676427 2818..3440 100 <- Minus

MIP05212.hyp Sequence

Translation from 0 to 2790

> MIP05212.hyp
RRDGIIIDKMKTTIVEERSVNETIETIATSSGSVQETIEIVNIDGSVAPK
HRHHHHHHRHHHHHERQENVEVVATEEVILVENAPKSRKHHHHKQRTSPP
PPLPQTSPPFLTPTEEVGFNVVWEPQAFWNQPSPNPSTDLDLSQDNEVVD
AVETMDTTSASDEFTTVVFQSETKESIRETQKHTRVVEEEIIIDQLDPPP
YAPPPLQVQTGFFPVAQQPPLSPIAEVVQTDVVAESVEPPLPPTGYIPRI
NLKPTETIVENVEVIVPAQIQQEPEFIPQPGFVARIVENIEVAAASKSSL
VSPQKSYYPRTGMVETIVEDIEVVKDDAPVQSGYIPGNVEVESIVENIDA
DSPFLLPPNGFATDESIVENIEVSTDVDDSPFLLPVNGFDSEPVCVESIV
ENIEVTPSQPVLQISDQSVVPAGFVESAVEDIQVIETEDPPFLLPTENDF
TAQAGNVESLIENIEVTTEVDLTLRQSEQIENLPRSGFVESIVENIEVTQ
EVDPPQPAVPSDVVTQSGLVESIVENIEVTEIVDIQAPAPPQTGFVESVV
ERLDVTEEVEPSVRPPLPLSYPPRSGFVESIVENIEVEQVTPSYQPPQQI
VPQSGFVETFVEDIEIKESALPPIQNGYAPQAGVVETIVEEVEIVPDPPR
QSIVTTDYMPRASLVQELVVESLEVTPTSSPPPEQFPFISRESLIVADDY
VEVEEVTPYNTAPHSPIVEVERLSEAESYVEINEVAPVNTPPQRSVEVGF
LPRPSLAETAVVVESVEVTPTPTPPPSPALKLKIPPSNQIPSEVIVDQPV
PSSTFKPPAKPLNNFILTDLVIDDPPFVEVVEREVVVESANNGQVTEVIE
VTEEIIQPVTPIGTVLVGEVSEQNSDKFGKRYSLSATLADGQQQVQGKPE
TNQSPPIQKRDKPTEPPKRRCCQCKCIIS*

MIP05212.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 13:55:09
Subject Length Description Subject Range Query Range Score Percent Strand
CG30480-PB 920 CG30480-PB 1..920 10..929 4716 100 Plus
CG30480-PA 920 CG30480-PA 1..920 10..929 4716 100 Plus
Msp300-PE 9606 CG42768-PE 5881..6667 81..861 231 21.3 Plus
Msp300-PE 9606 CG42768-PE 6536..7315 85..861 231 22.5 Plus
Msp300-PG 13540 CG42768-PG 5881..6667 81..861 231 21.3 Plus
Msp300-PG 13540 CG42768-PG 6536..7315 85..861 231 22.5 Plus
Msp300-PE 9606 CG42768-PE 5774..6563 82..865 227 22.1 Plus
Msp300-PE 9606 CG42768-PE 5989..6779 81..865 227 22.3 Plus
Msp300-PG 13540 CG42768-PG 5774..6563 82..865 227 22.1 Plus
Msp300-PG 13540 CG42768-PG 5989..6779 81..865 227 22.3 Plus
Msp300-PE 9606 CG42768-PE 6205..6991 81..861 225 22.2 Plus
Msp300-PG 13540 CG42768-PG 6205..6991 81..861 225 22.2 Plus
Msp300-PE 9606 CG42768-PE 6313..7099 81..861 220 22.8 Plus
Msp300-PG 13540 CG42768-PG 6313..7099 81..861 220 22.8 Plus
Msp300-PE 9606 CG42768-PE 6428..7207 85..861 218 22.6 Plus
Msp300-PG 13540 CG42768-PG 6428..7207 85..861 218 22.6 Plus
Msp300-PE 9606 CG42768-PE 6752..7532 85..865 212 22.4 Plus
Msp300-PG 13540 CG42768-PG 6752..7532 85..865 212 22.4 Plus
Msp300-PE 9606 CG42768-PE 6644..7423 85..861 211 22.2 Plus
Msp300-PG 13540 CG42768-PG 6644..7423 85..861 211 22.2 Plus
Msp300-PE 9606 CG42768-PE 5240..5807 256..865 175 23.9 Plus
Msp300-PG 13540 CG42768-PG 5240..5807 256..865 175 23.9 Plus
Cpn-PB 864 CG4795-PB 157..798 199..875 174 21.6 Plus
Msp300-PE 9606 CG42768-PE 4818..5591 75..865 168 21.4 Plus
Msp300-PG 13540 CG42768-PG 4818..5591 75..865 168 21.4 Plus

MIP05212.pep Sequence

Translation from 1 to 2790

> MIP05212.pep
RRDGIIIDKMKTTIVEERSVNETIETIATSSGSVQETIEIVNIDGSVAPK
HRHHHHHHRHHHHHERQENVEVVATEEVILVENAPKSRKHHHHKQRTSPP
PPLPQTSPPFLTPTEEVGFNVVWEPQAFWNQPSPNPSTDLDLSQDNEVVD
AVETMDTTSASDEFTTVVFQSETKESIRETQKHTRVVEEEIIIDQLDPPP
YAPPPLQVQTGFFPVAQQPPLSPIAEVVQTDVVAESVEPPLPPTGYIPRI
NLKPTETIVENVEVIVPAQIQQEPEFIPQPGFVARIVENIEVAAASKSSL
VSPQKSYYPRTGMVETIVEDIEVVKDDAPVQSGYIPGNVEVESIVENIDA
DSPFLLPPNGFATDESIVENIEVSTDVDDSPFLLPVNGFDSEPVCVESIV
ENIEVTPSQPVLQISDQSVVPAGFVESAVEDIQVIETEDPPFLLPTENDF
TAQAGNVESLIENIEVTTEVDLTLRQSEQIENLPRSGFVESIVENIEVTQ
EVDPPQPAVPSDVVTQSGLVESIVENIEVTEIVDIQAPAPPQTGFVESVV
ERLDVTEEVEPSVRPPLPLSYPPRSGFVESIVENIEVEQVTPSYQPPQQI
VPQSGFVETFVEDIEIKESALPPIQNGYAPQAGVVETIVEEVEIVPDPPR
QSIVTTDYMPRASLVQELVVESLEVTPTSSPPPEQFPFISRESLIVADDY
VEVEEVTPYNTAPHSPIVEVERLSEAESYVEINEVAPVNTPPQRSVEVGF
LPRPSLAETAVVVESVEVTPTPTPPPSPALKLKIPPSNQIPSEVIVDQPV
PSSTFKPPAKPLNNFILTDLVIDDPPFVEVVEREVVVESANNGQVTEVIE
VTEEIIQPVTPIGTVLVGEVSEQNSDKFGKRYSLSATLADGQQQVQGKPE
TNQSPPIQKRDKPTEPPKRRCCQCKCIIS*

MIP05212.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 06:39:39
Subject Length Description Subject Range Query Range Score Percent Strand
CG30480-PB 920 CG30480-PB 1..920 10..929 4716 100 Plus
CG30480-PA 920 CG30480-PA 1..920 10..929 4716 100 Plus
Msp300-PE 9606 CG42768-PE 5881..6667 81..861 231 21.3 Plus
Msp300-PE 9606 CG42768-PE 6536..7315 85..861 231 22.5 Plus
Msp300-PG 13540 CG42768-PG 5881..6667 81..861 231 21.3 Plus
Msp300-PG 13540 CG42768-PG 6536..7315 85..861 231 22.5 Plus
Msp300-PE 9606 CG42768-PE 5774..6563 82..865 227 22.1 Plus
Msp300-PE 9606 CG42768-PE 5989..6779 81..865 227 22.3 Plus
Msp300-PG 13540 CG42768-PG 5774..6563 82..865 227 22.1 Plus
Msp300-PG 13540 CG42768-PG 5989..6779 81..865 227 22.3 Plus
Msp300-PE 9606 CG42768-PE 6205..6991 81..861 225 22.2 Plus
Msp300-PG 13540 CG42768-PG 6205..6991 81..861 225 22.2 Plus
Msp300-PE 9606 CG42768-PE 6313..7099 81..861 220 22.8 Plus
Msp300-PG 13540 CG42768-PG 6313..7099 81..861 220 22.8 Plus
Msp300-PE 9606 CG42768-PE 6428..7207 85..861 218 22.6 Plus
Msp300-PG 13540 CG42768-PG 6428..7207 85..861 218 22.6 Plus
Msp300-PE 9606 CG42768-PE 6752..7532 85..865 212 22.4 Plus
Msp300-PG 13540 CG42768-PG 6752..7532 85..865 212 22.4 Plus
Msp300-PE 9606 CG42768-PE 6644..7423 85..861 211 22.2 Plus
Msp300-PG 13540 CG42768-PG 6644..7423 85..861 211 22.2 Plus
Msp300-PE 9606 CG42768-PE 5240..5807 256..865 175 23.9 Plus
Msp300-PG 13540 CG42768-PG 5240..5807 256..865 175 23.9 Plus
Cpn-PB 864 CG4795-PB 157..798 199..875 174 21.6 Plus
Msp300-PE 9606 CG42768-PE 4818..5591 75..865 168 21.4 Plus
Msp300-PG 13540 CG42768-PG 4818..5591 75..865 168 21.4 Plus
Blast to dper-all-translation-r1.3.fasta performed 2014-11-28 06:39:48
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL10630-PA 1190 GL10630-PA 851..1190 570..929 258 36.1 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2014-11-28 06:39:50
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA23284-PA 506 GA23284-PA 83..506 520..929 255 33.6 Plus