Clone MIP05284 Report

Search the DGRC for MIP05284

Clone and Library Details

Library:MIP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by:
Date Registered:2008-10-08
Comments:
Original Plate Number:52
Well:84
Vector:pOT2
Associated Gene/TranscriptCG32371-RA
Protein status:MIP05284.pep: gold
Sequenced Size:1078

Clone Sequence Records

MIP05284.complete Sequence

1078 bp assembled on 2009-04-06

GenBank Submission: BT081980.1

> MIP05284.complete
TTCGGCAAATCAGAGTATTCGTCAGTAGTCCAAACATTATTTAAATTTTT
CGTACAAAATGTCTGAGAAATCAAAAACATCAGTAGTGAATGTTCGCTAC
ACTAACAAGTTGTCGAGCAATTCTTCGCGTGCGGAAATGCTATCCTGGGT
GAATAACACGTTGAAATCGCAGTTTTTCAAGGTCGAGGAATTGTGCACCG
GAGCGGCATACTGCCAGTTAATGGACATACTGTTTGCCCGGTCGATCCCG
ATGCAGCGAGTCAAGTTTCGCACAAACGTTGAGTATGAGTACATCCAGAA
TTTCAAGCTTTTACAGGGATGTTTCAACAAATTTGTTGTTGATAAGATCA
TTCCCATCGACCGGCTGGTCAAGGGACGATACCAGGATAACTTCGAGTTC
CTTCAGTGGTTTCGCAAGTTCTTCGATGCCAACTATGAGAGTCGAGAATA
TGATCCTGTGATAGCTCGGAATGGAGCAATGCTGGGACTTGGCTCGCCTC
CCATGGAAGCCAAGTTACGCAAATCAGTGAATAAGTCAAATCCCCAAACT
AAACCCACCGAAGAATCCTCTGCTCAAACAGATAGGGCAACAACAGAACC
GAAAAATCAAGTGTATAAGTCAAATTCTGAAAATAAAACCATCGAAGAAG
CCTCTGCTCAAACAGATTTGGCAATAACAGAGCCGGAAAATCAAGTGCAT
GAATCCCAAACTAAAACCACCGAAAAAGCCTCTGCTCAAACAGAAAAAGC
AACAACAGAGCCGGATAGTGAAGGTTCCATTGAGGAGTTGCGGAATTACT
GTAAATATGTTTCGAGAATGAAACAGGAGAGGAACTTTTACTTATCAAAA
CTCCGAGCTATTGATCATATTTGCCAGAAATACAATAGTGGCCGAGATAG
GGTAATCTTAGAAAAGATTACTAAGATTATTTACAGCGAATAAATGTTCA
TAACAAGCACCAAATAAACTGCATTCAAATCGGCTAAGAAGCAAAATTCA
AAGCAATGTAGTTAGTTAAAAATCATAAGTTAATCTGTCAATAAATTTTT
AAAAGGAAAAAAAAAAAAAAAAAAAAAA

MIP05284.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 21:29:16
Subject Length Description Subject Range Query Range Score Percent Strand
CG32371-RA 1105 CG32371-RA 24..1075 1..1052 5260 100 Plus
Blast to d_melanogaster_OreR.fa performed 2014-11-27 15:43:21
Subject Length Description Subject Range Query Range Score Percent Strand
chr3L 24539361 chr3L 7759373..7760424 1052..1 5230 99.8 Minus
chr3L 24539361 chr3L 7759660..7759815 687..526 310 80.9 Minus
chr3L 24539361 chr3L 7759738..7759899 765..610 310 80.9 Minus
chr3L 24539361 chr3L 7759662..7759720 601..543 190 88.1 Minus
chr3L 24539361 chr3L 7759824..7759882 763..705 190 88.1 Minus
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 15:43:18
Subject Length Description Subject Range Query Range Score Percent Strand
CG32371-RA 885 CG32371-PA 1..885 59..943 4425 100 Plus
CG32371-RA 885 CG32371-PA 468..629 610..765 295 80.2 Plus
CG32371-RA 885 CG32371-PA 552..707 526..687 295 80.2 Plus
Eb1-RF 894 CG3265-PF 104..381 183..460 250 72.7 Plus
Eb1-RG 876 CG3265-PG 104..353 183..432 245 73.2 Plus
CG32371-RA 885 CG32371-PA 485..543 705..763 190 88.1 Plus
CG32371-RA 885 CG32371-PA 647..705 543..601 190 88.1 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 20:04:41 has no hits.
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 15:43:17
Subject Length Description Subject Range Query Range Score Percent Strand
CG32371-RA 1084 CG32371-RA 24..1075 1..1052 5260 100 Plus
CG32371-RA 1084 CG32371-RA 549..710 610..765 295 80.2 Plus
CG32371-RA 1084 CG32371-RA 633..788 526..687 295 80.2 Plus
Eb1-RF 1891 CG3265-RF 299..576 183..460 250 72.7 Plus
Eb1-RG 2043 CG3265-RG 206..455 183..432 245 73.2 Plus
CG32371-RA 1084 CG32371-RA 566..624 705..763 190 88.1 Plus
CG32371-RA 1084 CG32371-RA 728..786 543..601 190 88.1 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 15:43:20
Subject Length Description Subject Range Query Range Score Percent Strand
CG32371-PA 294 CG32371-PA 1..294 59..940 1512 100 Plus
Eb1-PG 291 CG3265-PG 3..273 86..937 582 44.1 Plus
Eb1-PA 291 CG3265-PA 3..273 86..937 582 44.1 Plus
Eb1-PD 291 CG3265-PD 3..273 86..937 582 44.1 Plus
Eb1-PB 291 CG3265-PB 3..273 86..937 582 44.1 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 15:43:15
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 7767278..7768329 1052..1 5260 100 Minus
3L 28110227 3L 7767565..7767720 687..526 295 80.2 Minus
3L 28110227 3L 7767643..7767804 765..610 295 80.2 Minus
3L 28110227 3L 7767567..7767625 601..543 190 88.1 Minus
3L 28110227 3L 7767729..7767787 763..705 190 88.1 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:45:55
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28103327 3L 7760378..7761429 1052..1 5260 100 Minus
Blast to na_te.dros performed on 2014-11-27 15:43:16 has no hits.

MIP05284.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2014-11-27 16:35:43 Download gff for MIP05284.complete
Subject Subject Range Query Range Percent Splice Strand
chr3L 7759369..7760424 1..1056 99   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2009-10-19 18:08:43 Download gff for MIP05284.complete
Subject Subject Range Query Range Percent Splice Strand
CG32371-RA 1..885 59..943 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 21:43:49 Download gff for MIP05284.complete
Subject Subject Range Query Range Percent Splice Strand
CG32371-RA 1..885 59..943 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 18:05:22 Download gff for MIP05284.complete
Subject Subject Range Query Range Percent Splice Strand
CG32371-RA 1..885 59..943 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 16:35:43 Download gff for MIP05284.complete
Subject Subject Range Query Range Percent Splice Strand
CG32371-RA 1..885 59..943 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2009-04-06 15:23:54 Download gff for MIP05284.complete
Subject Subject Range Query Range Percent Splice Strand
CG32371-RA 24..1079 1..1056 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 21:43:49 Download gff for MIP05284.complete
Subject Subject Range Query Range Percent Splice Strand
CG32371-RA 24..1079 1..1056 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 18:05:22 Download gff for MIP05284.complete
Subject Subject Range Query Range Percent Splice Strand
CG32371-RA 24..1079 1..1056 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 16:35:43 Download gff for MIP05284.complete
Subject Subject Range Query Range Percent Splice Strand
CG32371-RA 24..1079 1..1056 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 16:35:43 Download gff for MIP05284.complete
Subject Subject Range Query Range Percent Splice Strand
3L 7767274..7768329 1..1056 99   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 18:05:22 Download gff for MIP05284.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 7760374..7761429 1..1056 99   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 19:18:51 Download gff for MIP05284.complete
Subject Subject Range Query Range Percent Splice Strand
3L 7760374..7761429 1..1056 99   Minus

MIP05284.pep Sequence

Translation from 58 to 942

> MIP05284.pep
MSEKSKTSVVNVRYTNKLSSNSSRAEMLSWVNNTLKSQFFKVEELCTGAA
YCQLMDILFARSIPMQRVKFRTNVEYEYIQNFKLLQGCFNKFVVDKIIPI
DRLVKGRYQDNFEFLQWFRKFFDANYESREYDPVIARNGAMLGLGSPPME
AKLRKSVNKSNPQTKPTEESSAQTDRATTEPKNQVYKSNSENKTIEEASA
QTDLAITEPENQVHESQTKTTEKASAQTEKATTEPDSEGSIEELRNYCKY
VSRMKQERNFYLSKLRAIDHICQKYNSGRDRVILEKITKIIYSE*

MIP05284.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2014-11-28 08:12:12
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF23323-PA 338 GF23323-PA 9..253 10..291 538 41 Plus
Dana\GF11070-PA 434 GF11070-PA 11..145 3..137 532 67.4 Plus
Dana\GF13745-PA 240 GF13745-PA 6..120 10..124 383 53.9 Plus
Dana\GF11070-PA 434 GF11070-PA 210..416 82..293 274 31.2 Plus
Dana\GF20898-PA 335 GF20898-PA 19..118 27..121 169 36 Plus
Blast to dere-all-translation-r1.3.fasta performed 2014-11-28 08:12:14
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG23222-PA 393 GG23222-PA 2..135 9..142 533 67.9 Plus
Dere\GG20937-PA 248 GG20937-PA 6..184 10..186 379 42.8 Plus
Dere\GG18930-PA 625 GG18930-PA 8..146 11..146 332 46 Plus
Dere\GG23222-PA 393 GG23222-PA 192..375 97..293 272 34.3 Plus
Dere\GG24985-PA 907 GG24985-PA 5..118 14..127 239 38.6 Plus
Dere\GG18890-PA 209 GG18890-PA 23..145 30..147 191 34.1 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2014-11-28 08:12:15
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH21755-PA 377 GH21755-PA 2..139 9..146 540 67.4 Plus
Dgri\GH11211-PA 145 GH11211-PA 3..134 7..137 343 50.8 Plus
Dgri\GH19731-PA 243 GH19731-PA 2..123 5..124 337 47.5 Plus
Dgri\GH12721-PA 149 GH12721-PA 22..127 23..128 296 50.9 Plus
Dgri\GH21755-PA 377 GH21755-PA 180..359 101..293 237 32.8 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 08:12:11
Subject Length Description Subject Range Query Range Score Percent Strand
CG32371-PA 294 CG32371-PA 1..294 1..294 1512 100 Plus
Eb1-PG 291 CG3265-PG 3..273 10..293 582 44.1 Plus
Eb1-PA 291 CG3265-PA 3..273 10..293 582 44.1 Plus
Eb1-PD 291 CG3265-PD 3..273 10..293 582 44.1 Plus
Eb1-PB 291 CG3265-PB 3..273 10..293 582 44.1 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2014-11-28 08:12:17
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI19301-PA 423 GI19301-PA 2..140 9..147 533 66.2 Plus
Dmoj\GI16249-PA 266 GI16249-PA 2..236 9..291 496 39.7 Plus
Dmoj\GI15398-PA 493 GI15398-PA 10..176 11..179 351 44.2 Plus
Dmoj\GI14128-PA 207 GI14128-PA 7..138 9..138 340 47 Plus
Dmoj\GI20155-PA 236 GI20155-PA 2..103 23..124 340 52 Plus
Dmoj\GI19301-PA 423 GI19301-PA 210..405 85..293 261 34.9 Plus
Blast to dper-all-translation-r1.3.fasta performed 2014-11-28 08:12:19
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL11119-PA 414 GL11119-PA 3..138 10..145 533 67.6 Plus
Dper\GL10583-PA 257 GL10583-PA 6..126 10..130 348 47.9 Plus
Dper\GL11119-PA 414 GL11119-PA 196..396 88..293 273 34 Plus
Dper\GL24349-PA 199 GL24349-PA 13..124 19..130 227 38.4 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2014-11-28 08:12:21
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA17043-PA 381 GA17043-PA 3..138 10..145 535 67.6 Plus
Dpse\GA14834-PA 257 GA14834-PA 6..126 10..130 348 47.9 Plus
Dpse\GA17043-PA 381 GA17043-PA 180..363 97..293 268 34.3 Plus
Dpse\GA25462-PA 218 GA25462-PA 6..158 10..158 260 35.3 Plus
Dpse\GA26582-PA 229 GA26582-PA 1..124 9..130 233 37.9 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2014-11-28 08:12:23
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM20898-PA 393 GM20898-PA 2..135 9..142 536 68.7 Plus
Dsec\GM19864-PA 246 GM19864-PA 6..120 10..124 374 53 Plus
Dsec\GM20898-PA 393 GM20898-PA 192..375 97..293 287 35.5 Plus
Dsec\GM13642-PA 418 GM13642-PA 32..154 27..151 233 38.4 Plus
Dsec\GM11276-PA 183 GM11276-PA 18..140 30..147 199 31.7 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2014-11-28 08:12:25
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD10423-PA 393 GD10423-PA 2..135 9..142 536 68.7 Plus
Dsim\GD25351-PA 248 GD25351-PA 6..160 10..165 375 45.5 Plus
Dsim\GD10423-PA 393 GD10423-PA 192..375 97..293 287 35.5 Plus
Dsim\GD22515-PA 415 GD22515-PA 32..154 27..151 236 38.4 Plus
Dsim\GD23272-PA 367 GD23272-PA 7..118 16..127 227 41.1 Plus
Dsim\GD24542-PA 183 GD24542-PA 18..140 30..147 191 31.7 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2014-11-28 08:12:27
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ22178-PA 384 GJ22178-PA 2..139 9..146 548 68.1 Plus
Dvir\GJ16714-PA 257 GJ16714-PA 15..228 30..291 409 35.5 Plus
Dvir\GJ14795-PA 431 GJ14795-PA 12..153 5..145 349 46.9 Plus
Dvir\GJ22432-PA 236 GJ22432-PA 8..120 12..124 348 49.6 Plus
Dvir\GJ17762-PA 191 GJ17762-PA 4..190 7..214 342 38.6 Plus
Dvir\GJ22178-PA 384 GJ22178-PA 183..366 97..293 276 35 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2014-11-28 08:12:29
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK18120-PA 260 GK18120-PA 3..242 10..292 553 43.5 Plus
Dwil\GK22141-PA 373 GK22141-PA 2..138 9..145 531 67.2 Plus
Dwil\GK12829-PA 267 GK12829-PA 2..254 9..293 501 39.6 Plus
Dwil\GK20694-PA 252 GK20694-PA 6..120 10..124 367 53.9 Plus
Dwil\GK24903-PA 479 GK24903-PA 1..136 1..141 285 41.3 Plus
Dwil\GK22141-PA 373 GK22141-PA 168..355 97..293 279 35 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2014-11-28 08:12:30
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE19075-PA 385 GE19075-PA 2..135 9..142 533 68.7 Plus
Dyak\GE13874-PA 249 GE13874-PA 6..161 10..165 381 44.9 Plus
Dyak\GE15400-PA 495 GE15400-PA 10..152 7..146 343 46.2 Plus
Dyak\GE19075-PA 385 GE19075-PA 184..367 97..293 275 34.3 Plus
Dyak\GE18273-PA 546 GE18273-PA 5..118 14..127 233 38.6 Plus
Dyak\GE18379-PA 435 GE18379-PA 32..148 27..145 226 37.8 Plus

MIP05284.hyp Sequence

Translation from 58 to 942

> MIP05284.hyp
MSEKSKTSVVNVRYTNKLSSNSSRAEMLSWVNNTLKSQFFKVEELCTGAA
YCQLMDILFARSIPMQRVKFRTNVEYEYIQNFKLLQGCFNKFVVDKIIPI
DRLVKGRYQDNFEFLQWFRKFFDANYESREYDPVIARNGAMLGLGSPPME
AKLRKSVNKSNPQTKPTEESSAQTDRATTEPKNQVYKSNSENKTIEEASA
QTDLAITEPENQVHESQTKTTEKASAQTEKATTEPDSEGSIEELRNYCKY
VSRMKQERNFYLSKLRAIDHICQKYNSGRDRVILEKITKIIYSE*

MIP05284.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 15:24:19
Subject Length Description Subject Range Query Range Score Percent Strand
CG32371-PA 294 CG32371-PA 1..294 1..294 1512 100 Plus
Eb1-PG 291 CG3265-PG 3..273 10..293 582 44.1 Plus
Eb1-PA 291 CG3265-PA 3..273 10..293 582 44.1 Plus
Eb1-PD 291 CG3265-PD 3..273 10..293 582 44.1 Plus
Eb1-PB 291 CG3265-PB 3..273 10..293 582 44.1 Plus