Clone MIP05301 Report

Search the DGRC for MIP05301

Clone and Library Details

Library:MIP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by:
Date Registered:2008-10-08
Comments:
Original Plate Number:53
Well:1
Vector:pOT2
Associated Gene/Transcriptspaw-RA
Protein status:MIP05301.pep: gold
Sequenced Size:2684

Clone Sequence Records

MIP05301.complete Sequence

2684 bp assembled on 2009-04-28

GenBank Submission: BT082090.1

> MIP05301.complete
AGAAGGAACTCAAATTTAAGTTCACCAGCCATGCTCAACTCTTTGGCCAA
GAGAATTGTGCTTATGCCCAGCCTTATAGCACTGGAGGATACTTGTCGAA
CTATTCACGTTACCGCCCTAATGGCGAGGATGGGAAAGGATTTCTGTCCC
GTGAGTGAGGTTCCCGACTGCAAAGTGGTGAAGAAGCGACCGTGCAGTCC
CACGGATCCACCTGTTCGTCCTTGCAGCGAGGAGGGCTGCACCCAGCCGC
GATACTCATGTTGCGTGAGTACCGGCATTTCGGCGAATCCATGCGCTGAT
CCAAGCAAGAAGACCAAGTTCGTTTCGATGTGGAAGAGATACAAGGATGA
TGGTAGTAATCGGCCAGAAGCTATGTGGCACTACCCGGAGGAGTGCTGTC
CAAAGTGTGAGGATACGCGATTTGACGTTTTGTACTATACACCGTCGGAC
AAGTGCCGGGAGTTCCAGCGCACCTGGTGGGAATGCTGTCCAAAAATGGT
ACCGAAGCGGGTCTGCTGCTGGTGCGACGCCATTCCACCGGAGGTCCTGC
GGCGAGATTTGCCCATCTGCCCGCGATCCGCTTGTCTCGCAGAACATGAG
AGGAAGCGCTATAAGTGCCTAAACAAAAGGTACAAAGGTTGCATGCGTAT
CCGTATGCCGTGTTGTCGAACCGCTCGAATACCGCCCGACTGCAGGGCAT
TCCCCGGTCCTTCCGATTGCGAGAAGATCAAGTGCCCGTTCCCGAGTTAC
TCCGAATGCGTTCAGGAGGATCCCGCTGTTATCCCAACCCGGCCACCAGA
GTGTGAGTGCTTGAAAAAGGCGTCTCAGTGCGAGCAGATCCGACGAGGAC
GGCACATGGAAAACAACGACATAAGCATCTGGCCGTGTACTTCCAGGGGA
AGATGAAGACCGTATCCCAGGGTTATAGTAACTGGGGTCTTCGCTGGAAT
TTTTGTAACACAAAATGTAACAAAAATTCCAACAGAGACCAAAGTCCTGA
ACGGCAAGCCCTTCACCAGAAATCATAAACCTTTATAAACTCTTTTTATA
TTTATGATTTCTGGTGGTGTTGGGTATCCCTGTGGAATCCCCATCCCAGC
AACCCAACTGAAAATCTGTCAGTTGAGGTACATCTAATATCTCATTCAAT
TGGCATCCGGCACCCTGTTTAAAATTCAAAATTCTAGGCCTCGTTCAAAA
TTAAAACATGCCTCGCCTCTCGGTTTTCTGCGGATTATCGCGTAGAATCA
TCTGCTCCAGCACTGCTCACCGAAACCTTTGGCGACTGTTGTCCGACAGT
TCGGAGTCGACCATTATCCCACACGTTTCGGACAAAACGGAAAGTGTGAA
GAAATTCAAAAAGGAAACGCAGGTGGATCACACAAGTCACCTATTTGTAT
GGCCGGAGGCGAAGGACGAAAACGTTCATCATGTGAAAGAGAACAAAGAG
GATAGCAATGACGATATAACTGCATCCTGGGGCTGGAAAAATGACGAGCT
TGACGTGGAGCAATTGGCAGGACTACCAAGTCCTAATGAGGTGGAGGATC
CATACCGGCAGCCAAACAATGAATCTCAGGATGATCAGTTGCCATTCGCT
GAAGGAGACCAATCAGGAATTCAAGAAGAATTACAATTCGCAAGAACGCG
CTCCCTGCGAGAACAGCTTGTCAAGAATCAGGCGTCCCAAGAACCTTTTA
CCAGCTTTGAGAAAACATCTCTCACATCCGTTCGAAGGAATGTGGACTTC
ATGATGCAAGAGCTTAGTCAGATTTCACTTATTTTGAATACTATGGGAGG
AGGTGAAAAAACAATGGGGATGGTTAACTCTGAACCGGATGTGGCTTCCT
TTGCACTCAACCAACCCAAAATCAGTGAAAGTTTGAATCATGAGGAGGAA
TCAAATCAGTCAGTGGATAGAGCTAGTTCCCATCAATCTGAGCTAGGTGT
TGCAGATTCTATGCATTCGGAGGTAGCCAGTGCGCTCTCAGAACCATCTG
GATTGGGTGATGTAGAGAGCCTAGATCATAGCGAGATTTCGAACCAGTCT
TTTGATTCCGAACTAACGAGGGATATCACCGATCAACTTAAATTGGATCA
CGAGATGGAAGCAAATCAGTCTTTGGATTCTGAGTTAACCGGTGAAATAA
CTAATCAATCTAGTTCGGTAGTTTCAGAGTCTTCGATTTCCGATGAGGAC
TTCGGGGAGGAGCTAATAAAACAATCTCACAAAATCGAGCAAATTGCGTC
TGCTGGCGATACTCAAGAGTCCAGTCCTTCAAAAACCAATGAGAATACTC
CCAAGACTGATGACACGCAGGACACTCAGCCTAAGGAAACCATACACACC
TACAGGCCCTTTAGGACTATCGAAGTTCCTGCCAAGAAGCCTACTAGTAG
CCTTAGCACCGAGTCAATTGAAGAGCAGCCGTTGAACCAGGAACCCCAAT
TCGGCACAGGTATCCATTTAGATAGAGAACGGTACAAAGTTTCTGCTCAG
CTGACCGAGTCCGAGTCCCGCTTACTTATGCGCATGGCTCTGAAGCAGGC
TTTAATCGATCTGGAGTCTGGCCAAAGCAAGTACAAAGCAACAATTCTGG
AGGCTGAAACCGAGTAATACAAGAGCACCAATGACCAAAGAAATAAACAT
AACCTTTAAAACTTAAAAAAAAAAAAAAAAAAAA

MIP05301.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 16:22:41
Subject Length Description Subject Range Query Range Score Percent Strand
spaw-RA 2243 spaw-RA 1..1726 940..2665 8630 100 Plus
hubl-RA 934 hubl-RA 28..934 1..907 4535 100 Plus
Blast to d_melanogaster_OreR.fa performed 2014-11-27 00:30:45
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 4246989..4249652 2664..1 13260 99.8 Minus
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 00:30:41
Subject Length Description Subject Range Query Range Score Percent Strand
spaw-RB 1410 CG30365-PB 1..1410 1208..2617 7050 100 Plus
spaw-RA 1410 CG30365-PA 1..1410 1208..2617 7050 100 Plus
hubl-RB 876 CG30364-PB 1..876 31..906 4380 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 20:04:43 has no hits.
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 00:30:39
Subject Length Description Subject Range Query Range Score Percent Strand
spaw-RB 2691 CG30365-RB 28..2691 1..2664 13320 100 Plus
hubl-RB 2691 CG30364-RB 28..2691 1..2664 13320 100 Plus
spaw-RA 1552 CG30365-RA 1..1552 1113..2664 7760 100 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 00:30:44
Subject Length Description Subject Range Query Range Score Percent Strand
spaw-PB 469 CG30365-PB 1..469 1208..2614 2220 100 Plus
spaw-PA 469 CG30365-PA 1..469 1208..2614 2220 100 Plus
hubl-PB 291 CG30364-PB 1..291 31..903 1676 100 Plus
hubl-PA 291 CG30364-PA 1..291 31..903 1676 100 Plus
swif-PB 284 CG30366-PB 37..279 190..846 293 31 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 00:30:37
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 8359465..8362129 2665..1 13325 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 18:09:25
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 8360664..8363328 2665..1 13325 100 Minus
Blast to na_te.dros performed on 2014-11-27 00:30:38 has no hits.

MIP05301.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2014-11-27 01:47:44 Download gff for MIP05301.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 4246989..4249652 1..2664 99   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2009-10-19 17:51:08 Download gff for MIP05301.complete
Subject Subject Range Query Range Percent Splice Strand
CG30365-RA 1..1410 1208..2617 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 13:46:37 Download gff for MIP05301.complete
Subject Subject Range Query Range Percent Splice Strand
spaw-RA 1..1410 1208..2617 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 06:31:07 Download gff for MIP05301.complete
Subject Subject Range Query Range Percent Splice Strand
spaw-RA 1..1410 1208..2617 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 01:47:44 Download gff for MIP05301.complete
Subject Subject Range Query Range Percent Splice Strand
spaw-RA 1..1410 1208..2617 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2009-04-28 17:10:03 Download gff for MIP05301.complete
Subject Subject Range Query Range Percent Splice Strand
CG30365-RA 1..1725 940..2664 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 13:46:37 Download gff for MIP05301.complete
Subject Subject Range Query Range Percent Splice Strand
spaw-RA 1..1552 1113..2664 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 06:31:07 Download gff for MIP05301.complete
Subject Subject Range Query Range Percent Splice Strand
spaw-RB 28..2691 1..2664 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 01:47:44 Download gff for MIP05301.complete
Subject Subject Range Query Range Percent Splice Strand
hubl-RB 28..2691 1..2664 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 01:47:44 Download gff for MIP05301.complete
Subject Subject Range Query Range Percent Splice Strand
2R 8359466..8362129 1..2664 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 06:31:07 Download gff for MIP05301.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 4246971..4249634 1..2664 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 11:32:26 Download gff for MIP05301.complete
Subject Subject Range Query Range Percent Splice Strand
2R 8360665..8363328 1..2664 100   Minus

MIP05301.pep Sequence

Translation from 1207 to 2616

> MIP05301.pep
MPRLSVFCGLSRRIICSSTAHRNLWRLLSDSSESTIIPHVSDKTESVKKF
KKETQVDHTSHLFVWPEAKDENVHHVKENKEDSNDDITASWGWKNDELDV
EQLAGLPSPNEVEDPYRQPNNESQDDQLPFAEGDQSGIQEELQFARTRSL
REQLVKNQASQEPFTSFEKTSLTSVRRNVDFMMQELSQISLILNTMGGGE
KTMGMVNSEPDVASFALNQPKISESLNHEEESNQSVDRASSHQSELGVAD
SMHSEVASALSEPSGLGDVESLDHSEISNQSFDSELTRDITDQLKLDHEM
EANQSLDSELTGEITNQSSSVVSESSISDEDFGEELIKQSHKIEQIASAG
DTQESSPSKTNENTPKTDDTQDTQPKETIHTYRPFRTIEVPAKKPTSSLS
TESIEEQPLNQEPQFGTGIHLDRERYKVSAQLTESESRLLMRMALKQALI
DLESGQSKYKATILEAETE*

MIP05301.pep Blast Records

Blast to dere-all-translation-r1.3.fasta performed 2014-11-28 07:00:22
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG10656-PA 462 GG10656-PA 1..462 1..469 1769 74.5 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 07:00:19
Subject Length Description Subject Range Query Range Score Percent Strand
spaw-PB 469 CG30365-PB 1..469 1..469 2381 100 Plus
spaw-PA 469 CG30365-PA 1..469 1..469 2381 100 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2014-11-28 07:00:27
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM20700-PA 461 GM20700-PA 1..461 1..469 2173 88.7 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2014-11-28 07:00:28
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD15285-PA 468 GD15285-PA 1..468 1..469 2146 90 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2014-11-28 07:00:32
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE23137-PA 471 GE23137-PA 1..471 1..469 1790 75.8 Plus

MIP05301.hyp Sequence

Translation from 1207 to 2616

> MIP05301.hyp
MPRLSVFCGLSRRIICSSTAHRNLWRLLSDSSESTIIPHVSDKTESVKKF
KKETQVDHTSHLFVWPEAKDENVHHVKENKEDSNDDITASWGWKNDELDV
EQLAGLPSPNEVEDPYRQPNNESQDDQLPFAEGDQSGIQEELQFARTRSL
REQLVKNQASQEPFTSFEKTSLTSVRRNVDFMMQELSQISLILNTMGGGE
KTMGMVNSEPDVASFALNQPKISESLNHEEESNQSVDRASSHQSELGVAD
SMHSEVASALSEPSGLGDVESLDHSEISNQSFDSELTRDITDQLKLDHEM
EANQSLDSELTGEITNQSSSVVSESSISDEDFGEELIKQSHKIEQIASAG
DTQESSPSKTNENTPKTDDTQDTQPKETIHTYRPFRTIEVPAKKPTSSLS
TESIEEQPLNQEPQFGTGIHLDRERYKVSAQLTESESRLLMRMALKQALI
DLESGQSKYKATILEAETE*

MIP05301.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 17:01:54
Subject Length Description Subject Range Query Range Score Percent Strand
spaw-PB 469 CG30365-PB 1..469 1..469 2381 100 Plus
spaw-PA 469 CG30365-PA 1..469 1..469 2381 100 Plus