Clone MIP05340 Report

Search the DGRC for MIP05340

Clone and Library Details

Library:MIP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by:
Date Registered:2008-10-08
Comments:
Original Plate Number:53
Well:40
Vector:pOT2
Associated Gene/TranscriptTengl1-RA
Protein status:MIP05340.pep: gold
Sequenced Size:1111

Clone Sequence Records

MIP05340.complete Sequence

1111 bp assembled on 2009-09-15

GenBank Submission: BT099764.1

> MIP05340.complete
CACAATAAACAAGTTACCGATTTCGAATTTGTTTCTAATTTATAAGACAA
AATTGCTAGGATTTGATATAAAGGATCGATGGAAGCGCCGGTGAAGGGCA
TTATTGGTATTCTGGCCACTGCTGGATCGTTTTTTGCACTAGGAGCTTAC
TATCAGCACATCGATGTCATGCGAAAGATTCGACGATTGGAGCAACGAAA
CCCACATGCCTACTTTATCAGAAGGAAACTGTACGCACTGCTGGGAATTT
TCGCTGTGCGCCCTGATAACTCAGAATTCGACGTGGATACCGATGACTGC
CACAAGCTGGGCGGGATCATGAAGTACGGCTTCCCCAGCACCAATGATAT
CACCATAAATGAGACCTTTGACTTTGTGACCTCTTTCGATCGAAGAAACT
CTGCGATTCTGTGGATGTGCGAGCGGGTAGATCTGTCCAATCGCGTCGTC
TACGGGGATTCCACATCCGTGGCTCCAGCTGGAGCATTTGGACAGTCGGA
GGCAGCCAGGGTATTTTTCCTGTCCAACATTAGGCCCTTTCTAAACAGAG
GGTTCAATCTCACTGTCTGGGATCGACTGCTGCAGTACGTCCATGAGATG
AGTCAACGACATGGAACCGTGTATGCCTACACCGGATCAATTTACTTGCC
CCGGGAGCTAAAGTCGAACAGTTGGTTCCTGGAGTTCCAGTCGGAGGAGA
GAACCATGGTGGCCGTACCCACCCATTTCTTCAAGATCCTGGTCATTGAT
AAGAAGTTCGCGGGCGATACCATTCCCTATGCGGAGGCCTATGTGATGCC
CAACTCTCCGCTGAACAACAATGTCGAACTGAAGACGCTTCTCAGCGATG
TCCGGGAAATAGAAAACGCTACTGGTCTACGGTTCTTTGAAGGACTCGAC
CGCAACTTTGTCAACACCCAAGCATCAAATTCATTTGTCCCCTCAGTAAA
CGGTCCTTTAACAAATCCGTTAACGTTGCCGATGACTAATGCCTTAGACA
GTCACAGTGCCCTCACATCAAGTATTTCTCCAAAATAGAATATAAATACA
TATATGTTGAAGGAGACAATGATGGCCATGAGAAATCCTTCAGATAAAAA
AAAAAAAAAAA

MIP05340.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 21:29:52
Subject Length Description Subject Range Query Range Score Percent Strand
CG31682-RA 1124 CG31682-RA 24..1121 1..1098 5490 100 Plus
Blast to d_melanogaster_OreR.fa performed 2014-11-27 02:17:15
Subject Length Description Subject Range Query Range Score Percent Strand
chr2L 23010047 chr2L 2239160..2240015 1095..240 4175 99.2 Minus
chr2L 23010047 chr2L 2240087..2240326 240..1 1185 99.6 Minus
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 02:17:12
Subject Length Description Subject Range Query Range Score Percent Strand
Tengl1-RA 960 CG31682-PA 1..960 79..1038 4800 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 20:04:44 has no hits.
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 02:17:11
Subject Length Description Subject Range Query Range Score Percent Strand
Tengl1-RA 1108 CG31682-RA 14..1108 1..1095 5475 100 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 02:17:14
Subject Length Description Subject Range Query Range Score Percent Strand
Tengl1-PA 319 CG31682-PA 1..319 79..1035 1660 100 Plus
Tengl2-PA 318 CG32463-PA 13..300 100..906 460 34.2 Plus
Tengl4-PA 378 CG4683-PA 128..362 292..906 303 29.7 Plus
Tengl3-PA 337 CG31679-PA 22..325 133..960 270 27.3 Plus
EndoG-PA 310 CG8862-PA 1..304 79..918 260 27.1 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 02:17:08
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 2239411..2240269 1098..240 4295 100 Minus
2L 23513712 2L 2240341..2240580 240..1 1200 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:46:22
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 2239411..2240269 1098..240 4295 100 Minus
2L 23513712 2L 2240341..2240580 240..1 1200 100 Minus
Blast to na_te.dros performed on 2014-11-27 02:17:09 has no hits.

MIP05340.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2014-11-27 04:14:23 Download gff for MIP05340.complete
Subject Subject Range Query Range Percent Splice Strand
chr2L 2240087..2240326 1..240 99   Minus
chr2L 2239160..2240014 241..1095 99 <- Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2009-10-19 17:54:31 Download gff for MIP05340.complete
Subject Subject Range Query Range Percent Splice Strand
CG31682-RA 1..960 79..1038 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 21:44:33 Download gff for MIP05340.complete
Subject Subject Range Query Range Percent Splice Strand
CG31682-RA 1..960 79..1038 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 06:37:55 Download gff for MIP05340.complete
Subject Subject Range Query Range Percent Splice Strand
Tengl1-RA 1..960 79..1038 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 04:14:23 Download gff for MIP05340.complete
Subject Subject Range Query Range Percent Splice Strand
Tengl1-RA 1..960 79..1038 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2009-09-15 17:42:41 Download gff for MIP05340.complete
Subject Subject Range Query Range Percent Splice Strand
CG31682-RA 14..1108 1..1095 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 21:44:33 Download gff for MIP05340.complete
Subject Subject Range Query Range Percent Splice Strand
CG31682-RA 14..1108 1..1095 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 06:37:55 Download gff for MIP05340.complete
Subject Subject Range Query Range Percent Splice Strand
Tengl1-RA 14..1108 1..1095 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 04:14:23 Download gff for MIP05340.complete
Subject Subject Range Query Range Percent Splice Strand
Tengl1-RA 14..1108 1..1095 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 04:14:23 Download gff for MIP05340.complete
Subject Subject Range Query Range Percent Splice Strand
2L 2240341..2240580 1..240 100   Minus
2L 2239414..2240268 241..1095 100 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 06:37:55 Download gff for MIP05340.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 2240341..2240580 1..240 100   Minus
arm_2L 2239414..2240268 241..1095 100 <- Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 19:19:41 Download gff for MIP05340.complete
Subject Subject Range Query Range Percent Splice Strand
2L 2240341..2240580 1..240 100   Minus
2L 2239414..2240268 241..1095 100 <- Minus

MIP05340.pep Sequence

Translation from 78 to 1037

> MIP05340.pep
MEAPVKGIIGILATAGSFFALGAYYQHIDVMRKIRRLEQRNPHAYFIRRK
LYALLGIFAVRPDNSEFDVDTDDCHKLGGIMKYGFPSTNDITINETFDFV
TSFDRRNSAILWMCERVDLSNRVVYGDSTSVAPAGAFGQSEAARVFFLSN
IRPFLNRGFNLTVWDRLLQYVHEMSQRHGTVYAYTGSIYLPRELKSNSWF
LEFQSEERTMVAVPTHFFKILVIDKKFAGDTIPYAEAYVMPNSPLNNNVE
LKTLLSDVREIENATGLRFFEGLDRNFVNTQASNSFVPSVNGPLTNPLTL
PMTNALDSHSALTSSISPK*

MIP05340.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2014-11-28 08:41:49
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF15292-PA 313 GF15292-PA 3..290 6..291 1163 74 Plus
Dana\GF15293-PA 317 GF15293-PA 14..301 11..278 423 31.3 Plus
Dana\GF24166-PA 323 GF24166-PA 12..304 13..276 371 29.8 Plus
Dana\GF15294-PA 338 GF15294-PA 12..296 10..273 297 29.2 Plus
Dana\GF12638-PA 310 GF12638-PA 4..304 6..280 276 26.5 Plus
Blast to dere-all-translation-r1.3.fasta performed 2014-11-28 08:41:51
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG24540-PA 313 GG24540-PA 1..313 1..319 1513 89.3 Plus
Dere\GG24541-PA 318 GG24541-PA 13..300 8..276 462 34.2 Plus
Dere\GG17836-PA 379 GG17836-PA 133..365 77..279 340 31.6 Plus
Dere\GG22601-PA 310 GG22601-PA 1..304 1..280 262 26.7 Plus
Dere\GG24543-PA 337 GG24543-PA 12..292 10..269 256 26 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2014-11-28 08:41:53
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH13791-PA 306 GH13791-PA 1..302 1..291 942 59.7 Plus
Dgri\GH12970-PA 306 GH12970-PA 1..302 1..291 942 59.7 Plus
Dgri\GH13792-PA 318 GH13792-PA 15..300 12..276 459 35.2 Plus
Dgri\GH24683-PA 319 GH24683-PA 10..305 9..275 361 29.5 Plus
Dgri\GH13793-PA 324 GH13793-PA 22..300 19..273 352 30.7 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 08:41:47
Subject Length Description Subject Range Query Range Score Percent Strand
Tengl1-PA 319 CG31682-PA 1..319 1..319 1660 100 Plus
Tengl2-PA 318 CG32463-PA 13..300 8..276 460 34.2 Plus
Tengl4-PA 378 CG4683-PA 128..362 72..276 303 29.7 Plus
Tengl3-PA 337 CG31679-PA 22..325 19..294 270 27.3 Plus
EndoG-PA 310 CG8862-PA 1..304 1..280 260 27.1 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2014-11-28 08:41:55
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI17193-PA 312 GI17193-PA 1..294 1..282 966 62.8 Plus
Dmoj\GI18045-PA 317 GI18045-PA 9..301 7..278 427 34.4 Plus
Dmoj\GI21664-PA 381 GI21664-PA 136..365 77..276 322 31.2 Plus
Dmoj\GI18046-PA 336 GI18046-PA 16..299 13..273 307 28.6 Plus
Dmoj\GI19378-PA 310 GI19378-PA 6..304 5..280 297 29.4 Plus
Blast to dper-all-translation-r1.3.fasta performed 2014-11-28 08:41:56
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL19410-PA 304 GL19410-PA 18..297 14..273 435 34.6 Plus
Dper\GL25109-PA 385 GL25109-PA 139..377 77..285 332 30 Plus
Dper\GL11082-PA 304 GL11082-PA 6..294 5..276 274 28.2 Plus
Dper\GL13439-PA 314 GL13439-PA 6..278 5..260 247 27.7 Plus
Dper\GL24726-PA 229 GL24726-PA 71..219 127..276 241 33.6 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2014-11-28 08:41:57
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA16923-PA 317 GA16923-PA 18..297 14..273 425 34.6 Plus
Dpse\GA23686-PA 385 GA23686-PA 139..377 77..285 331 30 Plus
Dpse\GA24605-PA 304 GA24605-PA 6..294 5..276 278 28.5 Plus
Dpse\GA22360-PA 506 GA22360-PA 7..289 9..269 239 25.5 Plus
Dpse\GA22336-PA 308 GA22336-PA 107..286 80..273 217 27.8 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2014-11-28 08:41:58
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM18248-PA 331 GM18248-PA 1..318 1..318 1593 93.4 Plus
Dsec\GM18249-PA 316 GM18249-PA 38..298 36..276 417 34.8 Plus
Dsec\GM23913-PA 378 GM23913-PA 133..362 77..276 310 30.3 Plus
Dsec\GM18250-PA 337 GM18250-PA 12..335 10..307 275 26.9 Plus
Dsec\GM20380-PA 310 GM20380-PA 1..304 1..280 267 27.3 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2014-11-28 08:42:00
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD22854-PA 319 GD22854-PA 1..319 1..319 1598 93.4 Plus
Dsim\GD22855-PA 318 GD22855-PA 13..300 8..276 469 34.9 Plus
Dsim\GD18726-PA 378 GD18726-PA 133..362 77..276 316 30.8 Plus
Dsim\GD22856-PA 337 GD22856-PA 12..335 10..307 275 26.9 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2014-11-28 08:42:01
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ22336-PA 310 GJ22336-PA 3..306 1..299 988 61.1 Plus
Dvir\GJ22347-PA 318 GJ22347-PA 13..302 9..278 469 35 Plus
Dvir\GJ15788-PA 379 GJ15788-PA 137..365 77..275 334 32.2 Plus
Dvir\GJ22358-PA 336 GJ22358-PA 11..298 9..273 333 30.1 Plus
Dvir\GJ19936-PA 310 GJ19936-PA 6..299 5..275 269 28.7 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2014-11-28 08:42:02
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK15148-PA 300 GK15148-PA 2..287 4..283 1007 67.5 Plus
Dwil\GK14992-PA 322 GK14992-PA 18..306 14..278 484 36.2 Plus
Dwil\GK10249-PA 366 GK10249-PA 128..351 77..272 306 27.8 Plus
Dwil\GK14993-PA 314 GK14993-PA 11..295 9..273 286 28.5 Plus
Dwil\GK23216-PA 310 GK23216-PA 5..299 4..275 270 27.8 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2014-11-28 08:42:03
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE15173-PA 320 GE15173-PA 1..320 1..319 1522 89.1 Plus
Dyak\GE15178-PA 318 GE15178-PA 13..300 8..276 463 34.6 Plus
Dyak\GE26063-PA 379 GE26063-PA 133..362 77..276 337 31.6 Plus
Dyak\GE15179-PA 332 GE15179-PA 12..330 10..307 266 26.1 Plus
Dyak\GE13469-PA 310 GE13469-PA 1..304 1..280 260 26.7 Plus

MIP05340.hyp Sequence

Translation from 78 to 1037

> MIP05340.hyp
MEAPVKGIIGILATAGSFFALGAYYQHIDVMRKIRRLEQRNPHAYFIRRK
LYALLGIFAVRPDNSEFDVDTDDCHKLGGIMKYGFPSTNDITINETFDFV
TSFDRRNSAILWMCERVDLSNRVVYGDSTSVAPAGAFGQSEAARVFFLSN
IRPFLNRGFNLTVWDRLLQYVHEMSQRHGTVYAYTGSIYLPRELKSNSWF
LEFQSEERTMVAVPTHFFKILVIDKKFAGDTIPYAEAYVMPNSPLNNNVE
LKTLLSDVREIENATGLRFFEGLDRNFVNTQASNSFVPSVNGPLTNPLTL
PMTNALDSHSALTSSISPK*

MIP05340.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 14:49:08
Subject Length Description Subject Range Query Range Score Percent Strand
Tengl1-PA 319 CG31682-PA 1..319 1..319 1660 100 Plus
Tengl2-PA 318 CG32463-PA 13..300 8..276 460 34.2 Plus
Tengl4-PA 378 CG4683-PA 128..362 72..276 303 29.7 Plus
Tengl3-PA 337 CG31679-PA 22..325 19..294 270 27.3 Plus
EndoG-PA 310 CG8862-PA 1..304 1..280 260 27.1 Plus