Clone MIP05434 Report

Search the DGRC for MIP05434

Clone and Library Details

Library:MIP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by:
Date Registered:2008-10-08
Comments:
Original Plate Number:54
Well:34
Vector:pOT2|pOTB7_DraIII
Associated Gene/TranscriptScgdelta-RB
Protein status:MIP05434.pep: wuzgold
Sequenced Size:2335

Clone Sequence Records

MIP05434.complete Sequence

2335 bp assembled on 2009-02-19

GenBank Submission: BT064638.1

> MIP05434.complete
CAACTTGCAACTCGCAGTTCGCAAATGCAGGTAGCTGCAGTTGCAGTTGC
TGCAGGCATGCATAATTGAAGAGATGCACGTGTGAAGTCGCCAACAGCTG
GCGCCGCCAAAGTCATCAACTGGCGCATTTGTAGATGCACTTCCAGTGGC
ATCTGCAGCTCCCACTGCATGGGCGGCTAACTGCATCAGCCAGCTGCATA
CTTTAGTGCTTTGGTGCTTTGCCACCCATGTAACTCCGTAGCTCCGGAGT
AGCAGAGCAGATTTATGGACTCGATGGCTTCCAGGTCCAGACGCAGACTT
CTGCGCTTTATCATGGACAGCTCCCCGCGATTACCGTGCAAACCCATGGC
ATCCACCGTTGTCTTAGCACTATGGATTTGCGAACGAGGGCTCGACTCCT
TTGGAAATCACTCACAAAGTTGTCCAAATGCATGGAACAACGCATGTGGA
GCCTGCTGCCTCTTATGTCGAAAGTTTTTTTTTTTTTTTTTGACTCTACC
ATGCACCGCCGTTCATTGTTTGCTTGCACTCCTTGCAGGATACAGGATAC
GCAACCGGAGAGTCATGCACTTCCCATGCATCCACTAGCTGCAGTGCAGC
AGCGCCGGAATGTTGGCCGCTGGCAGCAGTGAGATCACTGACTTTGGGCC
ACACTCGCGCCAACTAACGGCTGGCAACACGCCCAAGCGACCCAACAAGG
CCAGCAGCCACCGTCCTGGTTCTGGTTCTGGTCCTGGCCCAATGACAACT
GGTGGCACCAGCTCAGCGAGCGGTAACGGAAACAGCGGTGGGGCTCTGAA
CGCCATTCCCACGACGAAGGTCGGGAGCGGAGGAGGCGGCGGAGGCGCCA
TGTCCGCCACAACGGTGACTGCGACGACGGGGAAAGCTACTGTAAGCCAT
GGCCATAGTCATGGCCACGCTCTGGGGCGCAGCGAGACGAGGAGCGGTCG
GAGCGCAGCAGCTGGACGCTCCAATGTGGACGGATTCGTTGGCGGAATCG
AGACGTACTTGGGCCTCATCGGGTGGCGAAAAAAGTGCCTGTATACCCTG
CTGCTACTGCTGATGCTGCTCATCATCACGAACCTGGTGCTCACCCTCTG
GATACTCAAGGAGGGCATGGGGCAGCTTAAAATCGTACCCGGTGGCATAC
AGCTGTCCGGACAAGCGATAATTATGGACATGCTGCGCGCCTCCACAATC
CGTTCGCGGCACGGTCAACCCATTTCCATAGAGTCATCACGTAACTTTTC
AATCAATACACGTGATCCGAATGGCATGATTGAGAATCATTTATTCCTGG
GACACGATAAGTTCGAGTGCCTGTCGGCGGGATTTCGCATAAACGACACC
AACGGACGCAGCCTGTTCTCCGTGAACCGAGATGAAGTCACCATCGGAGC
ACATGCCCTGCGGATCGACGGCGAAGGTGGCGCCGTCTTCCGGGAATCCG
TGCAGACGCCCCATGTGCGGGCCGAGCCCGGCCGGGAGCTGAGACTCGAA
TCGCCCACACGCCAATTGGAGATGACGGCGGCCAAGGACATCAATTTGCA
ATCGCGGGCAGGAGGCATAGAAGTCGTGGCCCTGGAAGACGTCAAGTTCC
GAGCCCTCGATGGGAGCCTGCGCCTGGAGTCCTCCAAGATACTTATGCCC
AACCTGCGGACGGCCCAGCCGCCCATTCTGGGCACTGCCCAAAGCAGGGA
TCACATGCACCGCGTCTTCCAACTCTGCGCCTGTTCCAATGGCAAGCTTT
TCCTCGCTGCACCCCACTCCATATGTGCCGGCGATGATTCCACGGTCTGC
AGATGATTGCACGATTCGGCGCGCTGGCAGTCAACATCTACATCGTCCAC
ATCCGATAGATCCCGATCCCGAATCCGATTCCGATCCGATACGGATACGA
ATACGGACACTCATTAAGGAGCTGTGTTCACACATGAACACGAATATATT
TAAAGACTTACAATTTTGGGCTCCGTTCATATCTTATGTAAATGAATCGA
GAGCGATAAATTATATTTAGGATTTTGTTATCTAAGGCGACATGGGTGCA
TTGCTCAAAAACATGTAATTTAAGTGCACACTACATGAGTCAGTCACTTG
AGATCGTTCCCCGCCTCCTAAAATAGTCCCTTAGTGGGAGACCACAGATA
AGGTCCTCGCCGCTCAAGATAGGCAGATGTGCCCGAGCGTGGGACCTCGA
TAAGGCGGGGACTATTTACTTAGGCCTCTGCGTAGGCCATTTACTTTAAG
ATGCGATTCTCATGTCACCTATTTAAACCGAAGATATTTCCAAATAAAAT
CAGTTTCTTACAAAAACTCAAAAAAAAAAAAAAAA

MIP05434.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 21:23:33
Subject Length Description Subject Range Query Range Score Percent Strand
Scgdelta-RB 2318 Scgdelta-RB 1..2318 1..2319 11525 99.8 Plus
Scgdelta-RD 2338 Scgdelta-RD 1127..2338 1110..2321 6060 100 Plus
Scgdelta-RA 2250 Scgdelta-RA 1041..2250 1110..2319 6050 100 Plus
Scgdelta-RD 2338 Scgdelta-RD 1..1110 1..1111 5485 99.7 Plus
Scgdelta-RA 2250 Scgdelta-RA 452..1024 539..1111 2865 100 Plus
Blast to d_melanogaster_OreR.fa performed 2014-11-26 21:14:31
Subject Length Description Subject Range Query Range Score Percent Strand
chrX 22417052 chrX 1643748..1644858 1111..1 5465 99.5 Minus
chrX 22417052 chrX 1639720..1640421 2319..1618 3480 99.7 Minus
chrX 22417052 chrX 16120499..16120895 2319..1923 1985 100 Minus
chr2R 21145070 chr2R 5758572..5758968 1923..2319 1985 100 Plus
chrX 22417052 chrX 57186..57581 1924..2319 1980 100 Plus
chr3R 27901430 chr3R 200462..200857 2319..1924 1980 100 Minus
chr3L 24539361 chr3L 9269879..9270274 2319..1924 1980 100 Minus
chr3L 24539361 chr3L 18526993..18527388 2319..1924 1980 100 Minus
chr3L 24539361 chr3L 18770351..18770746 2319..1924 1980 100 Minus
chr2LHet 368865 chr2LHet 197991..198386 2319..1924 1980 100 Minus
chr2L 23010047 chr2L 6425883..6426278 1924..2319 1980 100 Plus
chr2L 23010047 chr2L 22983808..22984203 2319..1924 1980 100 Minus
chrX 22417052 chrX 63955..64349 1925..2319 1975 100 Plus
chrX 22417052 chrX 966100..966494 1925..2319 1975 100 Plus
chrX 22417052 chrX 1631041..1631435 2319..1925 1975 100 Minus
chrX 22417052 chrX 2717704..2718098 2319..1925 1975 100 Minus
chrX 22417052 chrX 2725766..2726160 2319..1925 1975 100 Minus
chrX 22417052 chrX 3112202..3112596 2319..1925 1975 100 Minus
chrX 22417052 chrX 3120865..3121259 2319..1925 1975 100 Minus
chrX 22417052 chrX 3491083..3491477 1925..2319 1975 100 Plus
chrX 22417052 chrX 3495024..3495418 2319..1925 1975 100 Minus
chrX 22417052 chrX 3503649..3504043 1925..2319 1975 100 Plus
chrX 22417052 chrX 3507592..3507986 2319..1925 1975 100 Minus
chrX 22417052 chrX 4682362..4682756 2319..1925 1975 100 Minus
chrX 22417052 chrX 8840517..8840911 1925..2319 1975 100 Plus
chrX 22417052 chrX 8847541..8847935 1925..2319 1975 100 Plus
chrX 22417052 chrX 16112635..16113029 2319..1925 1975 100 Minus
chrX 22417052 chrX 16230484..16230878 2319..1925 1975 100 Minus
chrX 22417052 chrX 16239155..16239549 2319..1925 1975 100 Minus
chrX 22417052 chrX 18846198..18846592 2319..1925 1975 100 Minus
chrX 22417052 chrX 18854375..18854769 2319..1925 1975 100 Minus
chrX 22417052 chrX 21409464..21409858 2319..1925 1975 100 Minus
chrX 22417052 chrX 21415556..21415950 2319..1925 1975 100 Minus
chr2R 21145070 chr2R 1939..2333 1925..2319 1975 100 Plus
chr2R 21145070 chr2R 4218407..4218801 1925..2319 1975 100 Plus
chr2R 21145070 chr2R 5100320..5100714 1925..2319 1975 100 Plus
chr2R 21145070 chr2R 6064541..6064935 2319..1925 1975 100 Minus
chr2R 21145070 chr2R 6073222..6073616 2319..1925 1975 100 Minus
chr2R 21145070 chr2R 8676606..8677000 2319..1925 1975 100 Minus
chr2R 21145070 chr2R 8684483..8684877 2319..1925 1975 100 Minus
chr2R 21145070 chr2R 9980863..9981257 2319..1925 1975 100 Minus
chr2R 21145070 chr2R 9996528..9996922 2319..1925 1975 100 Minus
chr2R 21145070 chr2R 10363315..10363709 1925..2319 1975 100 Plus
chr2R 21145070 chr2R 14249253..14249647 2319..1925 1975 100 Minus
chr2R 21145070 chr2R 14257937..14258331 2319..1925 1975 100 Minus
chr2R 21145070 chr2R 14478069..14478463 1925..2319 1975 100 Plus
chr2R 21145070 chr2R 14486734..14487128 1925..2319 1975 100 Plus
chr2R 21145070 chr2R 17624755..17625149 1925..2319 1975 100 Plus
chr2R 21145070 chr2R 17633429..17633823 1925..2319 1975 100 Plus
chr2R 21145070 chr2R 20247317..20247711 1925..2319 1975 100 Plus
chr2R 21145070 chr2R 21027606..21028000 1925..2319 1975 100 Plus
chr2R 21145070 chr2R 21044810..21045204 1925..2319 1975 100 Plus
chr3R 27901430 chr3R 192565..192959 2319..1925 1975 100 Minus
chr3R 27901430 chr3R 4237752..4238146 1925..2319 1975 100 Plus
chr3R 27901430 chr3R 4427866..4428260 2319..1925 1975 100 Minus
chr3R 27901430 chr3R 13587607..13588001 2319..1925 1975 100 Minus
chr3R 27901430 chr3R 18063211..18063605 2319..1925 1975 100 Minus
chr3R 27901430 chr3R 18071785..18072179 2319..1925 1975 100 Minus
chr3R 27901430 chr3R 19658880..19659274 1925..2319 1975 100 Plus
chr3R 27901430 chr3R 19667545..19667939 1925..2319 1975 100 Plus
chr3R 27901430 chr3R 21655705..21656099 1925..2319 1975 100 Plus
chr3R 27901430 chr3R 21664401..21664795 1925..2319 1975 100 Plus
chr3R 27901430 chr3R 22333636..22334030 1925..2319 1975 100 Plus
chr3R 27901430 chr3R 22342211..22342605 1925..2319 1975 100 Plus
chr3R 27901430 chr3R 22633769..22634163 2319..1925 1975 100 Minus
chr3R 27901430 chr3R 23344143..23344537 1925..2319 1975 100 Plus
chr3R 27901430 chr3R 23352866..23353260 1925..2319 1975 100 Plus
chr3R 27901430 chr3R 26218806..26219200 1925..2319 1975 100 Plus
chr3R 27901430 chr3R 26226586..26226980 1925..2319 1975 100 Plus
chr3L 24539361 chr3L 110260..110654 2319..1925 1975 100 Minus
chr3L 24539361 chr3L 118941..119335 2319..1925 1975 100 Minus
chr3L 24539361 chr3L 789693..790087 1925..2319 1975 100 Plus
chr3L 24539361 chr3L 6398157..6398551 1925..2319 1975 100 Plus
chr3L 24539361 chr3L 6424135..6424529 1925..2319 1975 100 Plus
chr3L 24539361 chr3L 7908997..7909391 1925..2319 1975 100 Plus
chr3L 24539361 chr3L 7917682..7918076 1925..2319 1975 100 Plus
chr3L 24539361 chr3L 8473858..8474252 2319..1925 1975 100 Minus
chr3L 24539361 chr3L 8482531..8482925 2319..1925 1975 100 Minus
chr3L 24539361 chr3L 9262610..9263004 2319..1925 1975 100 Minus
chr3L 24539361 chr3L 9493623..9494017 1925..2319 1975 100 Plus
chr3L 24539361 chr3L 11490020..11490414 2319..1925 1975 100 Minus
chr3L 24539361 chr3L 11498693..11499087 2319..1925 1975 100 Minus
chr3L 24539361 chr3L 13810140..13810534 2319..1925 1975 100 Minus
chr3L 24539361 chr3L 18518318..18518712 2319..1925 1975 100 Minus
chr3L 24539361 chr3L 18762156..18762550 2319..1925 1975 100 Minus
chr3L 24539361 chr3L 19837953..19838347 2319..1925 1975 100 Minus
chr3L 24539361 chr3L 19846657..19847051 2319..1925 1975 100 Minus
chr3L 24539361 chr3L 24001401..24001795 2319..1925 1975 100 Minus
chr3L 24539361 chr3L 24009256..24009650 2319..1925 1975 100 Minus
chr2L 23010047 chr2L 6430570..6430964 2319..1925 1975 100 Minus
chr2L 23010047 chr2L 6443658..6444052 1925..2319 1975 100 Plus
chr2L 23010047 chr2L 7342443..7342837 1925..2319 1975 100 Plus
chr2L 23010047 chr2L 7349073..7349467 1925..2319 1975 100 Plus
chr2L 23010047 chr2L 8999277..8999671 2319..1925 1975 100 Minus
chr2L 23010047 chr2L 10954483..10954877 1925..2319 1975 100 Plus
chr2L 23010047 chr2L 14641344..14641738 2319..1925 1975 100 Minus
chr2L 23010047 chr2L 14650021..14650415 2319..1925 1975 100 Minus
chr2L 23010047 chr2L 18059264..18059658 1925..2319 1975 100 Plus
chr2L 23010047 chr2L 21439597..21439991 1925..2319 1975 100 Plus
chr2L 23010047 chr2L 21448304..21448698 1925..2319 1975 100 Plus
chr2L 23010047 chr2L 21559321..21559715 2319..1925 1975 100 Minus
chr2L 23010047 chr2L 21568324..21568718 2319..1925 1975 100 Minus
chr2L 23010047 chr2L 21980299..21980693 2319..1925 1975 100 Minus
chrU 10048995 chrU 2245314..2245708 1925..2319 1975 100 Plus
chrU 10048995 chrU 5578137..5578531 1925..2319 1975 100 Plus
chr3LHet 2555433 chr3LHet 342020..342414 2319..1925 1975 100 Minus
chr2RHet 3288813 chr2RHet 3279632..3280026 1925..2319 1975 100 Plus
chr2RHet 3288813 chr2RHet 3288318..3288712 1925..2319 1975 100 Plus
chr2R 21145070 chr2R 6906124..6906520 2319..1923 1970 99.7 Minus
chr3L 24539361 chr3L 18037461..18037857 1923..2319 1970 99.7 Plus
chr2L 23010047 chr2L 18050590..18050983 1926..2319 1970 100 Plus
chr2L 23010047 chr2L 21988977..21989370 2319..1926 1970 100 Minus
chrU 10048995 chrU 8000054..8000450 2319..1923 1970 99.7 Minus
chrX 22417052 chrX 957794..958186 1927..2319 1965 100 Plus
chrX 22417052 chrX 2293804..2294199 1924..2319 1965 99.7 Plus
chrX 22417052 chrX 22392441..22392836 1924..2319 1965 99.7 Plus
chr2R 21145070 chr2R 10354651..10355043 1927..2319 1965 100 Plus
chr3R 27901430 chr3R 4229074..4229466 1927..2319 1965 100 Plus
chr3R 27901430 chr3R 4436533..4436925 2319..1927 1965 100 Minus
chr3R 27901430 chr3R 24581375..24581770 1924..2319 1965 99.7 Plus
chr3R 27901430 chr3R 27718614..27719009 2319..1924 1965 99.7 Minus
chr3L 24539361 chr3L 5042432..5042827 2319..1924 1965 99.7 Minus
chr3L 24539361 chr3L 6213475..6213870 1924..2319 1965 99.7 Plus
chr2L 23010047 chr2L 9006301..9006693 2319..1927 1965 100 Minus
chrX 22417052 chrX 2301672..2302066 1925..2319 1960 99.7 Plus
chrX 22417052 chrX 3386683..3387077 2319..1925 1960 99.7 Minus
chrX 22417052 chrX 3395356..3395750 2319..1925 1960 99.7 Minus
chrX 22417052 chrX 4882852..4883246 2319..1925 1960 99.7 Minus
chrX 22417052 chrX 7017286..7017680 1925..2319 1960 99.7 Plus
chrX 22417052 chrX 7025959..7026353 1925..2319 1960 99.7 Plus
chrX 22417052 chrX 10577501..10577895 2319..1925 1960 99.7 Minus
chrX 22417052 chrX 10582152..10582546 2319..1925 1960 99.7 Minus
chrX 22417052 chrX 11634844..11635238 1925..2319 1960 99.7 Plus
chrX 22417052 chrX 14827131..14827525 1925..2319 1960 99.7 Plus
chrX 22417052 chrX 14835902..14836296 1925..2319 1960 99.7 Plus
chrX 22417052 chrX 20702100..20702494 1925..2319 1960 99.7 Plus
chrX 22417052 chrX 20709217..20709611 1925..2319 1960 99.7 Plus
chrX 22417052 chrX 20927109..20927503 2319..1925 1960 99.7 Minus
chrX 22417052 chrX 22399190..22399584 1925..2319 1960 99.7 Plus
chr2R 21145070 chr2R 5367652..5368046 2319..1925 1960 99.7 Minus
chr2R 21145070 chr2R 6897436..6897830 2319..1925 1960 99.7 Minus
chr2R 21145070 chr2R 16255575..16255969 1925..2319 1960 99.7 Plus
chr2R 21145070 chr2R 16264252..16264646 1925..2319 1960 99.7 Plus
chr3R 27901430 chr3R 8689931..8690325 1925..2319 1960 99.7 Plus
chr3R 27901430 chr3R 10028018..10028412 1925..2319 1960 99.7 Plus
chr3R 27901430 chr3R 15265435..15265829 1925..2319 1960 99.7 Plus
chr3R 27901430 chr3R 15274105..15274499 1925..2319 1960 99.7 Plus
chr3R 27901430 chr3R 15980753..15981147 2319..1925 1960 99.7 Minus
chr3R 27901430 chr3R 15989437..15989831 2319..1925 1960 99.7 Minus
chr3R 27901430 chr3R 21548924..21549318 2319..1925 1960 99.7 Minus
chr3R 27901430 chr3R 24586507..24586901 1925..2319 1960 99.7 Plus
chr3R 27901430 chr3R 25704540..25704934 1925..2319 1960 99.7 Plus
chr3R 27901430 chr3R 25713211..25713605 1925..2319 1960 99.7 Plus
chr3R 27901430 chr3R 27711280..27711674 2319..1925 1960 99.7 Minus
chr3L 24539361 chr3L 2447050..2447444 1925..2319 1960 99.7 Plus
chr3L 24539361 chr3L 2455720..2456114 1925..2319 1960 99.7 Plus
chr3L 24539361 chr3L 5033766..5034160 2319..1925 1960 99.7 Minus
chr3L 24539361 chr3L 6222142..6222536 1925..2319 1960 99.7 Plus
chr3L 24539361 chr3L 6406829..6407223 1925..2319 1960 99.7 Plus
chr3L 24539361 chr3L 6415485..6415879 1925..2319 1960 99.7 Plus
chr3L 24539361 chr3L 6886839..6887233 1925..2319 1960 99.7 Plus
chr3L 24539361 chr3L 9929828..9930222 1925..2319 1960 99.7 Plus
chr3L 24539361 chr3L 13794783..13795177 1925..2319 1960 99.7 Plus
chr3L 24539361 chr3L 13801450..13801844 2319..1925 1960 99.7 Minus
chr3L 24539361 chr3L 18046034..18046428 1925..2319 1960 99.7 Plus
chr3L 24539361 chr3L 20111795..20112189 2319..1925 1960 99.7 Minus
chr3L 24539361 chr3L 21295211..21295605 1925..2319 1960 99.7 Plus
chr3L 24539361 chr3L 21303884..21304278 1925..2319 1960 99.7 Plus
chr2LHet 368865 chr2LHet 214662..215056 1925..2319 1960 99.7 Plus
chr2LHet 368865 chr2LHet 269579..269973 1925..2319 1960 99.7 Plus
chr2L 23010047 chr2L 5826847..5827241 2319..1925 1960 99.7 Minus
chr2L 23010047 chr2L 5835369..5835763 2319..1925 1960 99.7 Minus
chr2L 23010047 chr2L 6434987..6435381 1925..2319 1960 99.7 Plus
chr2L 23010047 chr2L 13851901..13852295 2319..1925 1960 99.7 Minus
chr2L 23010047 chr2L 19651129..19651523 1925..2319 1960 99.7 Plus
chr2L 23010047 chr2L 19672077..19672471 1925..2319 1960 99.7 Plus
chr2L 23010047 chr2L 19702151..19702545 2319..1925 1960 99.7 Minus
chr2L 23010047 chr2L 21602837..21603231 1925..2319 1960 99.7 Plus
chr2L 23010047 chr2L 22496919..22497313 2319..1925 1960 99.7 Minus
chr2L 23010047 chr2L 22505577..22505971 2319..1925 1960 99.7 Minus
chrU 10048995 chrU 8855634..8856028 1925..2319 1960 99.7 Plus
chr2R 21145070 chr2R 17639557..17639953 1923..2319 1955 99.5 Plus
chr3R 27901430 chr3R 21557598..21557991 2319..1926 1955 99.7 Minus
chr2L 23010047 chr2L 19710801..19711194 2319..1926 1955 99.7 Minus
chr2R 21145070 chr2R 17696011..17696406 1924..2319 1950 99.5 Plus
chr3R 27901430 chr3R 16154984..16155376 1927..2319 1950 99.7 Plus
chr3L 24539361 chr3L 9921537..9921929 1927..2319 1950 99.7 Plus
chr3L 24539361 chr3L 15927787..15928182 2319..1924 1950 99.5 Minus
chr2L 23010047 chr2L 21595581..21595973 1927..2319 1950 99.7 Plus
chrX 22417052 chrX 721590..721984 1925..2319 1945 99.5 Plus
chrX 22417052 chrX 728896..729290 1925..2319 1945 99.5 Plus
chrX 22417052 chrX 10158975..10159369 2319..1925 1945 99.5 Minus
chrX 22417052 chrX 10167639..10168033 2319..1925 1945 99.5 Minus
chr2R 21145070 chr2R 8594844..8595238 1925..2319 1945 99.5 Plus
chr2R 21145070 chr2R 8602724..8603118 1925..2319 1945 99.5 Plus
chr2R 21145070 chr2R 17703766..17704160 1925..2319 1945 99.5 Plus
chr3R 27901430 chr3R 7204809..7205203 2319..1925 1945 99.5 Minus
chr3R 27901430 chr3R 13462718..13463112 1925..2319 1945 99.5 Plus
chr3R 27901430 chr3R 22839151..22839545 1925..2319 1945 99.5 Plus
chr3L 24539361 chr3L 13515446..13515840 1925..2319 1945 99.5 Plus
chr3L 24539361 chr3L 13522756..13523150 1925..2319 1945 99.5 Plus
chr3L 24539361 chr3L 15919126..15919520 2319..1925 1945 99.5 Minus
chr2L 23010047 chr2L 686929..687323 2319..1925 1945 99.5 Minus
chr2L 23010047 chr2L 695483..695877 2319..1925 1945 99.5 Minus
chr2L 23010047 chr2L 976835..977229 1925..2319 1945 99.5 Plus
chr2L 23010047 chr2L 983986..984380 1925..2319 1945 99.5 Plus
chr2L 23010047 chr2L 996709..997103 2319..1925 1945 99.5 Minus
chr2L 23010047 chr2L 1005318..1005712 2319..1925 1945 99.5 Minus
chr2RHet 3288813 chr2RHet 1269779..1270173 1925..2319 1945 99.5 Plus
chr2RHet 3288813 chr2RHet 1278440..1278834 1925..2319 1945 99.5 Plus
chr2R 21145070 chr2R 5377697..5378087 2319..1929 1940 99.7 Minus
chrX 22417052 chrX 4889580..4889969 2319..1930 1935 99.7 Minus
chr3R 27901430 chr3R 10019359..10019748 1930..2319 1935 99.7 Plus
chr3R 27901430 chr3R 19508158..19508550 1927..2319 1935 99.5 Plus
chr3R 27901430 chr3R 22830504..22830896 1927..2319 1935 99.5 Plus
chr3L 24539361 chr3L 14286147..14286539 2319..1927 1935 99.5 Minus
chr2R 21145070 chr2R 20239441..20239836 1925..2319 1930 99.7 Plus
chr3R 27901430 chr3R 22199453..22199848 2319..1925 1930 99.7 Minus
chr3R 27901430 chr3R 22208126..22208521 2319..1925 1930 99.7 Minus
chr2L 23010047 chr2L 8451386..8451781 1925..2319 1930 99.7 Plus
chr2L 23010047 chr2L 8460070..8460465 1925..2319 1930 99.7 Plus
chr2L 23010047 chr2L 10945753..10946148 1925..2319 1930 99.7 Plus
chrU 10048995 chrU 8670360..8670755 1925..2319 1930 99.7 Plus
chr2RHet 3288813 chr2RHet 2936013..2936408 2319..1925 1930 99.7 Minus
chr3L 24539361 chr3L 6879832..6880228 1924..2319 1920 99.5 Plus
chr2LHet 368865 chr2LHet 260896..261288 1927..2319 1920 99.2 Plus
chrX 22417052 chrX 14004314..14004709 1925..2319 1915 99.5 Plus
chr2R 21145070 chr2R 3097299..3097694 2319..1925 1915 99.5 Minus
chr2R 21145070 chr2R 3104560..3104955 2319..1925 1915 99.5 Minus
chr2R 21145070 chr2R 5239817..5240212 2319..1925 1915 99.5 Minus
chr2R 21145070 chr2R 5248479..5248874 2319..1925 1915 99.5 Minus
chr2R 21145070 chr2R 8368512..8368907 2319..1925 1915 99.5 Minus
chr2R 21145070 chr2R 8369829..8370224 2319..1925 1915 99.5 Minus
chr3R 27901430 chr3R 26139866..26140261 1925..2319 1915 99.5 Plus
chr3R 27901430 chr3R 26146971..26147366 1925..2319 1915 99.5 Plus
chr3L 24539361 chr3L 1153719..1154114 1925..2319 1915 99.5 Plus
chr3L 24539361 chr3L 1162383..1162778 1925..2319 1915 99.5 Plus
chr3L 24539361 chr3L 16935229..16935624 1925..2319 1915 99.5 Plus
chr2L 23010047 chr2L 2100204..2100599 2319..1925 1915 99.5 Minus
chr2L 23010047 chr2L 2108868..2109263 2319..1925 1915 99.5 Minus
chrX 22417052 chrX 13995651..13996045 1926..2319 1910 99.5 Plus
chr2L 23010047 chr2L 21401592..21401989 1925..2319 1910 99.2 Plus
chr3R 27901430 chr3R 7213477..7213873 2319..1924 1905 99.2 Minus
chr2R 21145070 chr2R 21035243..21035637 1925..2319 1900 98.7 Plus
chr2L 23010047 chr2L 13860564..13860959 2319..1925 1900 99.2 Minus
chr2R 21145070 chr2R 438644..439039 2319..1925 1840 98.2 Minus
chr3LHet 2555433 chr3LHet 2425650..2426044 2319..1924 1825 98 Minus
chr2L 23010047 chr2L 22810061..22810454 1925..2319 1820 98 Plus
chr3LHet 2555433 chr3LHet 2145287..2145680 1925..2319 1820 98 Plus
chrU 10048995 chrU 3037985..3038378 1925..2319 1805 97.7 Plus
chr3LHet 2555433 chr3LHet 2136804..2137197 1925..2319 1805 97.7 Plus
chr2RHet 3288813 chr2RHet 1362569..1362962 1925..2319 1805 97.7 Plus
chr2RHet 3288813 chr2RHet 1364523..1364916 1925..2319 1805 97.7 Plus
chrU 10048995 chrU 3497066..3497460 1924..2319 1795 97.5 Plus
chr3LHet 2555433 chr3LHet 622853..623246 1925..2319 1790 97.5 Plus
chr3LHet 2555433 chr3LHet 2383290..2383683 1925..2319 1775 97.2 Plus
chr3LHet 2555433 chr3LHet 1589710..1590104 2319..1924 1765 97 Minus
chrU 10048995 chrU 3353570..3353963 1925..2319 1760 97 Plus
chrU 10048995 chrU 7513626..7514019 2319..1925 1760 97 Minus
chr3LHet 2555433 chr3LHet 1212352..1212744 2319..1925 1760 97 Minus
chr2RHet 3288813 chr2RHet 1359053..1359446 2319..1925 1760 97 Minus
chrU 10048995 chrU 1827185..1827579 2319..1924 1750 96.7 Minus
chrU 10048995 chrU 7744604..7744999 2319..1925 1750 96.7 Minus
chrU 10048995 chrU 3501858..3502251 1925..2319 1745 96.7 Plus
chrU 10048995 chrU 9593763..9594111 1971..2319 1745 100 Plus
chr3RHet 2517486 chr3RHet 1030805..1031198 2319..1925 1730 96.5 Minus
chr3LHet 2555433 chr3LHet 1220250..1220638 2315..1925 1725 96.7 Minus
chr3LHet 2555433 chr3LHet 1581417..1581807 2319..1925 1710 96.7 Minus
chr2RHet 3288813 chr2RHet 1573441..1573835 1925..2319 1600 95.2 Plus
chr3LHet 2555433 chr3LHet 577885..578277 1925..2319 1580 93.9 Plus
chr2RHet 3288813 chr2RHet 2618480..2618858 2319..1925 1575 94.4 Minus
chrU 10048995 chrU 5822978..5823359 1925..2319 1555 94.7 Plus
chr3LHet 2555433 chr3LHet 533794..534181 2319..1925 1555 94 Minus
chr3LHet 2555433 chr3LHet 1304609..1304991 2319..1925 1545 93.9 Minus
chr3LHet 2555433 chr3LHet 1297506..1297888 2319..1925 1530 93.7 Minus
chr2RHet 3288813 chr2RHet 1341816..1342147 2319..1987 1510 97.6 Minus
chrU 10048995 chrU 9134067..9134442 2319..1924 1475 92.7 Minus
chrU 10048995 chrU 9854492..9854866 2319..1925 1470 92.7 Minus
chrU 10048995 chrU 6040348..6040722 2319..1925 1445 91.6 Minus
chrU 10048995 chrU 3194767..3195101 1925..2267 1425 95 Plus
chrU 10048995 chrU 8646799..8647101 2227..1924 1365 97.4 Minus
chrU 10048995 chrU 6983505..6983831 2263..1925 1360 94.1 Minus
chr2RHet 3288813 chr2RHet 1297354..1297705 2319..1979 1360 93.8 Minus
chr2R 21145070 chr2R 5755378..5755717 1972..2319 1330 93.4 Plus
chr2RHet 3288813 chr2RHet 2883911..2884310 2319..1925 1330 89.2 Minus
chr2LHet 368865 chr2LHet 359290..359566 2043..2319 1295 97.8 Plus
chrU 10048995 chrU 4262858..4263190 2267..1925 1280 93.6 Minus
chrU 10048995 chrU 7525648..7525893 2319..2074 1140 97.6 Minus
chrU 10048995 chrU 10026596..10026840 1925..2169 1105 96.7 Plus
chrU 10048995 chrU 2714502..2714738 2083..2319 1080 97 Plus
chrU 10048995 chrU 2704727..2704960 2083..2316 1065 97 Plus
chr2R 21145070 chr2R 2207860..2208062 2116..2319 925 98 Plus
chrU 10048995 chrU 2714369..2714500 1925..2056 615 97.7 Plus
chrU 10048995 chrU 8369309..8369429 2319..2199 590 99.2 Minus
chrU 10048995 chrU 2704594..2704725 1925..2056 570 95.5 Plus
chr2LHet 368865 chr2LHet 347650..347765 1923..2038 550 98.3 Plus
chr2RHet 3288813 chr2RHet 2611054..2611157 2028..1925 520 100 Minus
chrU 10048995 chrU 10026839..10026939 2210..2310 460 97 Plus
chr2R 21145070 chr2R 5756641..5756743 2217..2319 455 96.1 Plus
chr2LHet 368865 chr2LHet 50716..50805 2014..1925 420 97.8 Minus
chr2L 23010047 chr2L 22802909..22802987 1925..2003 395 100 Plus
chrU 10048995 chrU 7525942..7525999 1982..1925 275 98.3 Minus
chrU 10048995 chrU 9279823..9279872 1925..1974 250 100 Plus
chrU 10048995 chrU 9204543..9204589 2273..2319 235 100 Plus
chr2R 21145070 chr2R 2181332..2181374 1925..1967 215 100 Plus
chr2RHet 3288813 chr2RHet 1342148..1342190 1967..1925 215 100 Minus
chr2LHet 368865 chr2LHet 347770..347812 2059..2101 185 95.3 Plus
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 21:14:24
Subject Length Description Subject Range Query Range Score Percent Strand
Scgdelta-RE 1215 CG14808-PE 1..1215 610..1806 5770 98.5 Plus
Scgdelta-RD 1215 CG14808-PD 1..1215 610..1806 5770 98.5 Plus
Scgdelta-RC 1215 CG14808-PC 1..1215 610..1806 5770 98.5 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 20:04:51 has no hits.
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 21:14:23
Subject Length Description Subject Range Query Range Score Percent Strand
Scgdelta-RD 2336 CG14808-RD 1..2336 1..2319 11300 99.1 Plus
Scgdelta-RA 2149 CG14808-RA 351..2149 539..2319 8690 99 Plus
Scgdelta-RE 2972 CG14808-RE 351..1753 539..1923 6710 98.7 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-26 21:14:27
Subject Length Description Subject Range Query Range Score Percent Strand
Scgdelta-PE 404 CG14808-PE 1..404 610..1803 1538 98.5 Plus
Scgdelta-PD 404 CG14808-PD 1..404 610..1803 1538 98.5 Plus
Scgdelta-PC 404 CG14808-PC 1..404 610..1803 1538 98.5 Plus
Scgdelta-PA 404 CG14808-PA 1..404 610..1803 1538 98.5 Plus
Obp73a-PB 259 CG13027-PB 227..259 1919..2017 174 93.9 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 21:14:14
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 1749912..1751021 1111..1 5475 99.7 Minus
X 23542271 X 1745876..1746579 2321..1618 3520 100 Minus
X 23542271 X 21894367..21894766 1922..2321 2000 100 Plus
X 23542271 X 16230728..16231126 2321..1923 1995 100 Minus
2R 25286936 2R 9871094..9871492 1923..2321 1995 100 Plus
X 23542271 X 160808..161205 1924..2321 1990 100 Plus
2R 25286936 2R 14467348..14467745 1924..2321 1990 100 Plus
3R 32079331 3R 4374741..4375138 2321..1924 1990 100 Minus
3R 32079331 3R 8610520..8610917 2321..1924 1990 100 Minus
3L 28110227 3L 9277973..9278370 2321..1924 1990 100 Minus
3L 28110227 3L 18537389..18537786 2321..1924 1990 100 Minus
3L 28110227 3L 18780690..18781087 2321..1924 1990 100 Minus
2L 23513712 2L 6426910..6427307 1924..2321 1990 100 Plus
2L 23513712 2L 23092571..23092968 2321..1924 1990 100 Minus
2L 23513712 2L 23342458..23342855 2321..1924 1990 100 Minus
X 23542271 X 167577..167973 1925..2321 1985 100 Plus
X 23542271 X 1063811..1064207 1925..2321 1985 100 Plus
X 23542271 X 1072119..1072515 1925..2321 1985 100 Plus
X 23542271 X 1737197..1737593 2321..1925 1985 100 Minus
X 23542271 X 2823874..2824270 2321..1925 1985 100 Minus
X 23542271 X 2831936..2832332 2321..1925 1985 100 Minus
X 23542271 X 3218592..3218988 2321..1925 1985 100 Minus
X 23542271 X 3227255..3227651 2321..1925 1985 100 Minus
X 23542271 X 3597606..3598002 1925..2321 1985 100 Plus
X 23542271 X 3601545..3601941 2321..1925 1985 100 Minus
X 23542271 X 3610172..3610568 1925..2321 1985 100 Plus
X 23542271 X 3614113..3614509 2321..1925 1985 100 Minus
X 23542271 X 8948814..8949210 1925..2321 1985 100 Plus
X 23542271 X 8955838..8956234 1925..2321 1985 100 Plus
X 23542271 X 16222864..16223260 2321..1925 1985 100 Minus
X 23542271 X 16340754..16341150 2321..1925 1985 100 Minus
X 23542271 X 16349425..16349821 2321..1925 1985 100 Minus
X 23542271 X 18957156..18957552 2321..1925 1985 100 Minus
X 23542271 X 18965333..18965729 2321..1925 1985 100 Minus
X 23542271 X 21544304..21544700 2321..1925 1985 100 Minus
X 23542271 X 21550396..21550792 2321..1925 1985 100 Minus
2R 25286936 2R 4105748..4106144 1925..2321 1985 100 Plus
2R 25286936 2R 4114434..4114830 1925..2321 1985 100 Plus
2R 25286936 2R 8330918..8331314 1925..2321 1985 100 Plus
2R 25286936 2R 9212749..9213145 1925..2321 1985 100 Plus
2R 25286936 2R 10176966..10177362 2321..1925 1985 100 Minus
2R 25286936 2R 10185647..10186043 2321..1925 1985 100 Minus
2R 25286936 2R 12789381..12789777 2321..1925 1985 100 Minus
2R 25286936 2R 12797258..12797654 2321..1925 1985 100 Minus
2R 25286936 2R 14093521..14093917 2321..1925 1985 100 Minus
2R 25286936 2R 14109186..14109582 2321..1925 1985 100 Minus
2R 25286936 2R 14476015..14476411 1925..2321 1985 100 Plus
2R 25286936 2R 18362169..18362565 2321..1925 1985 100 Minus
2R 25286936 2R 18370853..18371249 2321..1925 1985 100 Minus
2R 25286936 2R 18590923..18591319 1925..2321 1985 100 Plus
2R 25286936 2R 18599588..18599984 1925..2321 1985 100 Plus
2R 25286936 2R 21738333..21738729 1925..2321 1985 100 Plus
2R 25286936 2R 21747007..21747403 1925..2321 1985 100 Plus
2R 25286936 2R 24361360..24361756 1925..2321 1985 100 Plus
2R 25286936 2R 25141706..25142102 1925..2321 1985 100 Plus
2R 25286936 2R 25158910..25159306 1925..2321 1985 100 Plus
3R 32079331 3R 2051941..2052337 2321..1925 1985 100 Minus
3R 32079331 3R 3048865..3049261 2321..1925 1985 100 Minus
3R 32079331 3R 4366844..4367240 2321..1925 1985 100 Minus
3R 32079331 3R 8403063..8403459 1925..2321 1985 100 Plus
3R 32079331 3R 8411743..8412139 1925..2321 1985 100 Plus
3R 32079331 3R 8601853..8602249 2321..1925 1985 100 Minus
3R 32079331 3R 17763249..17763645 2321..1925 1985 100 Minus
3R 32079331 3R 22239578..22239974 2321..1925 1985 100 Minus
3R 32079331 3R 22248152..22248548 2321..1925 1985 100 Minus
3R 32079331 3R 23835459..23835855 1925..2321 1985 100 Plus
3R 32079331 3R 23844124..23844520 1925..2321 1985 100 Plus
3R 32079331 3R 25832746..25833142 1925..2321 1985 100 Plus
3R 32079331 3R 25841442..25841838 1925..2321 1985 100 Plus
3R 32079331 3R 26510557..26510953 1925..2321 1985 100 Plus
3R 32079331 3R 26519132..26519528 1925..2321 1985 100 Plus
3R 32079331 3R 26810639..26811035 2321..1925 1985 100 Minus
3R 32079331 3R 27521213..27521609 1925..2321 1985 100 Plus
3R 32079331 3R 27529936..27530332 1925..2321 1985 100 Plus
3R 32079331 3R 30396273..30396669 1925..2321 1985 100 Plus
3R 32079331 3R 30404053..30404449 1925..2321 1985 100 Plus
3L 28110227 3L 110298..110694 2321..1925 1985 100 Minus
3L 28110227 3L 118979..119375 2321..1925 1985 100 Minus
3L 28110227 3L 789969..790365 1925..2321 1985 100 Plus
3L 28110227 3L 6405714..6406110 1925..2321 1985 100 Plus
3L 28110227 3L 6431692..6432088 1925..2321 1985 100 Plus
3L 28110227 3L 7916884..7917280 1925..2321 1985 100 Plus
3L 28110227 3L 7925569..7925965 1925..2321 1985 100 Plus
3L 28110227 3L 8481859..8482255 2321..1925 1985 100 Minus
3L 28110227 3L 8490532..8490928 2321..1925 1985 100 Minus
3L 28110227 3L 9270704..9271100 2321..1925 1985 100 Minus
3L 28110227 3L 9501756..9502152 1925..2321 1985 100 Plus
3L 28110227 3L 11499143..11499539 2321..1925 1985 100 Minus
3L 28110227 3L 11507816..11508212 2321..1925 1985 100 Minus
3L 28110227 3L 13819956..13820352 2321..1925 1985 100 Minus
3L 28110227 3L 18528714..18529110 2321..1925 1985 100 Minus
3L 28110227 3L 18772495..18772891 2321..1925 1985 100 Minus
3L 28110227 3L 19848588..19848984 2321..1925 1985 100 Minus
3L 28110227 3L 19857292..19857688 2321..1925 1985 100 Minus
3L 28110227 3L 24012492..24012888 2321..1925 1985 100 Minus
3L 28110227 3L 24020347..24020743 2321..1925 1985 100 Minus
3L 28110227 3L 24858688..24859084 2321..1925 1985 100 Minus
2L 23513712 2L 6431595..6431991 2321..1925 1985 100 Minus
2L 23513712 2L 6444685..6445081 1925..2321 1985 100 Plus
2L 23513712 2L 7343381..7343777 1925..2321 1985 100 Plus
2L 23513712 2L 7350011..7350407 1925..2321 1985 100 Plus
2L 23513712 2L 9000366..9000762 2321..1925 1985 100 Minus
2L 23513712 2L 9007390..9007786 2321..1925 1985 100 Minus
2L 23513712 2L 10946999..10947395 1925..2321 1985 100 Plus
2L 23513712 2L 10955728..10956124 1925..2321 1985 100 Plus
2L 23513712 2L 14642657..14643053 2321..1925 1985 100 Minus
2L 23513712 2L 14651334..14651730 2321..1925 1985 100 Minus
2L 23513712 2L 18051931..18052327 1925..2321 1985 100 Plus
2L 23513712 2L 18060606..18061002 1925..2321 1985 100 Plus
2L 23513712 2L 21441096..21441492 1925..2321 1985 100 Plus
2L 23513712 2L 21449803..21450199 1925..2321 1985 100 Plus
2L 23513712 2L 21560824..21561220 2321..1925 1985 100 Minus
2L 23513712 2L 21569827..21570223 2321..1925 1985 100 Minus
2L 23513712 2L 21981769..21982165 2321..1925 1985 100 Minus
2L 23513712 2L 21990447..21990843 2321..1925 1985 100 Minus
U 3151297 U 2814000..2814396 1925..2321 1985 100 Plus
Ymm 880023 Ymm 269928..270324 2321..1925 1985 100 Minus
2R 25286936 2R 11018589..11018987 2321..1923 1980 99.7 Minus
3L 28110227 3L 18047761..18048159 1923..2321 1980 99.7 Plus
X 23542271 X 2399892..2400289 1924..2321 1975 99.7 Plus
X 23542271 X 4996858..4997255 2321..1924 1975 99.7 Minus
X 23542271 X 22996362..22996759 1924..2321 1975 99.7 Plus
2R 25286936 2R 9490208..9490605 2321..1924 1975 99.7 Minus
3R 32079331 3R 1655235..1655632 1924..2321 1975 99.7 Plus
3R 32079331 3R 14194482..14194879 1924..2321 1975 99.7 Plus
3R 32079331 3R 28758340..28758737 1924..2321 1975 99.7 Plus
3R 32079331 3R 31896260..31896657 2321..1924 1975 99.7 Minus
3L 28110227 3L 5042911..5043308 2321..1924 1975 99.7 Minus
3L 28110227 3L 6220969..6221366 1924..2321 1975 99.7 Plus
3L 28110227 3L 14296068..14296468 2322..1922 1975 99.5 Minus
X 23542271 X 2407760..2408156 1925..2321 1970 99.7 Plus
X 23542271 X 3493178..3493574 2321..1925 1970 99.7 Minus
X 23542271 X 3501851..3502247 2321..1925 1970 99.7 Minus
X 23542271 X 4990130..4990526 2321..1925 1970 99.7 Minus
X 23542271 X 7125301..7125697 1925..2321 1970 99.7 Plus
X 23542271 X 7133974..7134370 1925..2321 1970 99.7 Plus
X 23542271 X 10686137..10686533 2321..1925 1970 99.7 Minus
X 23542271 X 10690788..10691184 2321..1925 1970 99.7 Minus
X 23542271 X 11743622..11744018 1925..2321 1970 99.7 Plus
X 23542271 X 14936915..14937311 1925..2321 1970 99.7 Plus
X 23542271 X 14945686..14946082 1925..2321 1970 99.7 Plus
X 23542271 X 20836781..20837177 1925..2321 1970 99.7 Plus
X 23542271 X 20843898..20844294 1925..2321 1970 99.7 Plus
X 23542271 X 21061950..21062346 2321..1925 1970 99.7 Minus
X 23542271 X 21903241..21903637 1925..2321 1970 99.7 Plus
X 23542271 X 23003111..23003507 1925..2321 1970 99.7 Plus
2R 25286936 2R 2409113..2409509 2321..1925 1970 99.7 Minus
2R 25286936 2R 2417776..2418172 2321..1925 1970 99.7 Minus
2R 25286936 2R 2421013..2421409 2321..1925 1970 99.7 Minus
2R 25286936 2R 9480163..9480559 2321..1925 1970 99.7 Minus
2R 25286936 2R 11009901..11010297 2321..1925 1970 99.7 Minus
2R 25286936 2R 20368567..20368963 1925..2321 1970 99.7 Plus
2R 25286936 2R 20377244..20377640 1925..2321 1970 99.7 Plus
3R 32079331 3R 1663906..1664302 1925..2321 1970 99.7 Plus
3R 32079331 3R 12864617..12865013 1925..2321 1970 99.7 Plus
3R 32079331 3R 14203147..14203543 1925..2321 1970 99.7 Plus
3R 32079331 3R 19441561..19441957 1925..2321 1970 99.7 Plus
3R 32079331 3R 19450231..19450627 1925..2321 1970 99.7 Plus
3R 32079331 3R 20156777..20157173 2321..1925 1970 99.7 Minus
3R 32079331 3R 20165461..20165857 2321..1925 1970 99.7 Minus
3R 32079331 3R 20331054..20331450 1925..2321 1970 99.7 Plus
3R 32079331 3R 25725915..25726311 2321..1925 1970 99.7 Minus
3R 32079331 3R 25734589..25734985 2321..1925 1970 99.7 Minus
3R 32079331 3R 28763472..28763868 1925..2321 1970 99.7 Plus
3R 32079331 3R 29882075..29882471 1925..2321 1970 99.7 Plus
3R 32079331 3R 29890746..29891142 1925..2321 1970 99.7 Plus
3R 32079331 3R 31888926..31889322 2321..1925 1970 99.7 Minus
3L 28110227 3L 2447560..2447956 1925..2321 1970 99.7 Plus
3L 28110227 3L 2456230..2456626 1925..2321 1970 99.7 Plus
3L 28110227 3L 5034245..5034641 2321..1925 1970 99.7 Minus
3L 28110227 3L 6229636..6230032 1925..2321 1970 99.7 Plus
3L 28110227 3L 6414386..6414782 1925..2321 1970 99.7 Plus
3L 28110227 3L 6423042..6423438 1925..2321 1970 99.7 Plus
3L 28110227 3L 6894579..6894975 1925..2321 1970 99.7 Plus
3L 28110227 3L 9929723..9930119 1925..2321 1970 99.7 Plus
3L 28110227 3L 9938016..9938412 1925..2321 1970 99.7 Plus
3L 28110227 3L 13804601..13804997 1925..2321 1970 99.7 Plus
3L 28110227 3L 13811266..13811662 2321..1925 1970 99.7 Minus
3L 28110227 3L 18056334..18056730 1925..2321 1970 99.7 Plus
3L 28110227 3L 20122515..20122911 2321..1925 1970 99.7 Minus
3L 28110227 3L 21306203..21306599 1925..2321 1970 99.7 Plus
3L 28110227 3L 21314876..21315272 1925..2321 1970 99.7 Plus
2L 23513712 2L 5827794..5828190 2321..1925 1970 99.7 Minus
2L 23513712 2L 5836316..5836712 2321..1925 1970 99.7 Minus
2L 23513712 2L 6436014..6436410 1925..2321 1970 99.7 Plus
2L 23513712 2L 13853171..13853567 2321..1925 1970 99.7 Minus
2L 23513712 2L 19652628..19653024 1925..2321 1970 99.7 Plus
2L 23513712 2L 19673576..19673972 1925..2321 1970 99.7 Plus
2L 23513712 2L 19703623..19704019 2321..1925 1970 99.7 Minus
2L 23513712 2L 19712273..19712669 2321..1925 1970 99.7 Minus
2L 23513712 2L 21597085..21597481 1925..2321 1970 99.7 Plus
2L 23513712 2L 21604343..21604739 1925..2321 1970 99.7 Plus
2L 23513712 2L 22605697..22606093 2321..1925 1970 99.7 Minus
2L 23513712 2L 22614355..22614751 2321..1925 1970 99.7 Minus
2L 23513712 2L 23359134..23359530 1925..2321 1970 99.7 Plus
2L 23513712 2L 23367806..23368202 1925..2321 1970 99.7 Plus
2L 23513712 2L 23414397..23414793 1925..2321 1970 99.7 Plus
2R 25286936 2R 21753137..21753535 1923..2321 1965 99.5 Plus
2R 25286936 2R 21809579..21809976 1924..2321 1960 99.5 Plus
3L 28110227 3L 15937944..15938341 2321..1924 1960 99.5 Minus
X 23542271 X 827657..828053 1925..2321 1955 99.5 Plus
X 23542271 X 834963..835359 1925..2321 1955 99.5 Plus
X 23542271 X 10267389..10267785 2321..1925 1955 99.5 Minus
X 23542271 X 10276053..10276449 2321..1925 1955 99.5 Minus
2R 25286936 2R 2499040..2499436 1925..2321 1955 99.5 Plus
2R 25286936 2R 2507701..2508097 1925..2321 1955 99.5 Plus
2R 25286936 2R 12707571..12707967 1925..2321 1955 99.5 Plus
2R 25286936 2R 12715451..12715847 1925..2321 1955 99.5 Plus
2R 25286936 2R 21817334..21817730 1925..2321 1955 99.5 Plus
3R 32079331 3R 11379322..11379718 2321..1925 1955 99.5 Minus
3R 32079331 3R 17638373..17638769 1925..2321 1955 99.5 Plus
3R 32079331 3R 23684752..23685148 1925..2321 1955 99.5 Plus
3R 32079331 3R 27007460..27007856 1925..2321 1955 99.5 Plus
3R 32079331 3R 27016109..27016505 1925..2321 1955 99.5 Plus
3L 28110227 3L 13525212..13525608 1925..2321 1955 99.5 Plus
3L 28110227 3L 13532522..13532918 1925..2321 1955 99.5 Plus
3L 28110227 3L 15929283..15929679 2321..1925 1955 99.5 Minus
2L 23513712 2L 687005..687401 2321..1925 1955 99.5 Minus
2L 23513712 2L 695559..695955 2321..1925 1955 99.5 Minus
2L 23513712 2L 976935..977331 1925..2321 1955 99.5 Plus
2L 23513712 2L 984085..984481 1925..2321 1955 99.5 Plus
2L 23513712 2L 996811..997207 2321..1925 1955 99.5 Minus
2L 23513712 2L 1005420..1005816 2321..1925 1955 99.5 Minus
3L 28110227 3L 27815048..27815446 1924..2321 1945 99.7 Plus
2L 23513712 2L 23405711..23406108 1924..2321 1945 99.2 Plus
2R 25286936 2R 24353484..24353881 1925..2321 1940 99.7 Plus
3R 32079331 3R 26376411..26376808 2321..1925 1940 99.7 Minus
3R 32079331 3R 26385084..26385481 2321..1925 1940 99.7 Minus
3L 28110227 3L 27514596..27514993 1925..2321 1940 99.7 Plus
3L 28110227 3L 27823685..27824082 1925..2321 1940 99.7 Plus
2L 23513712 2L 8452476..8452873 1925..2321 1940 99.7 Plus
2L 23513712 2L 8461160..8461557 1925..2321 1940 99.7 Plus
X 23542271 X 14105078..14105475 1925..2321 1925 99.5 Plus
2R 25286936 2R 7209927..7210324 2321..1925 1925 99.5 Minus
2R 25286936 2R 7217188..7217585 2321..1925 1925 99.5 Minus
2R 25286936 2R 9352311..9352708 2321..1925 1925 99.5 Minus
2R 25286936 2R 9360973..9361370 2321..1925 1925 99.5 Minus
2R 25286936 2R 12481223..12481620 2321..1925 1925 99.5 Minus
2R 25286936 2R 12482540..12482937 2321..1925 1925 99.5 Minus
3R 32079331 3R 30317381..30317778 1925..2321 1925 99.5 Plus
3R 32079331 3R 30324486..30324883 1925..2321 1925 99.5 Plus
2L 23513712 2L 2100461..2100858 2321..1925 1925 99.5 Minus
2L 23513712 2L 2109125..2109522 2321..1925 1925 99.5 Minus
2L 23513712 2L 21403091..21403490 1925..2321 1920 99.2 Plus
3R 32079331 3R 11387990..11388388 2321..1924 1915 99.2 Minus
2R 25286936 2R 25149343..25149739 1925..2321 1910 98.7 Plus
2L 23513712 2L 13861834..13862231 2321..1925 1910 99.2 Minus
2R 25286936 2R 4551035..4551432 2321..1925 1850 98.2 Minus
2L 23513712 2L 22918836..22919231 1925..2321 1830 98 Plus
2R 25286936 2R 2591830..2592225 1925..2321 1815 97.7 Plus
2R 25286936 2R 2593784..2594179 1925..2321 1815 97.7 Plus
3CEN 744266 3CEN 26228..26623 1925..2321 1815 97.7 Plus
2R 25286936 2R 2588312..2588707 2321..1925 1770 97 Minus
3CEN 744266 3CEN 46191..46586 1925..2321 1770 97 Plus
Y 3667352 Y 3133636..3134031 2321..1925 1770 97 Minus
Y 3667352 Y 3168948..3169343 1925..2321 1770 97 Plus
Ymm 880023 Ymm 349789..350186 1925..2321 1760 96.7 Plus
Ymm 880023 Ymm 375087..375484 1925..2321 1760 96.7 Plus
Xmm 1049845 Xmm 913315..913698 1925..2321 1565 94.7 Plus
U 3151297 U 1357687..1358064 2321..1924 1485 92.7 Minus
Y 3667352 Y 866838..867214 1925..2321 1480 92.7 Plus
Y 3667352 Y 869279..869655 2321..1925 1480 92.7 Minus
Y 3667352 Y 604304..604685 2321..1927 1470 92.7 Minus
Y 3667352 Y 609323..609704 2321..1927 1470 92.7 Minus
U 3151297 U 723661..724037 2321..1925 1455 91.7 Minus
Ymm 880023 Ymm 358593..358927 1925..2267 1425 95 Plus
U 3151297 U 1881647..1881949 2227..1924 1365 97.4 Minus
U 3151297 U 2753037..2753363 2263..1925 1360 94.1 Minus
Ymm 880023 Ymm 391096..391428 2267..1925 1280 93.6 Minus
U 3151297 U 2123711..2123958 2321..2074 1150 97.6 Minus
U 3151297 U 2589136..2589380 1925..2169 1105 96.7 Plus
U 3151297 U 1531872..1531994 2321..2199 600 99.2 Minus
U 3151297 U 2589379..2589479 2210..2310 460 97 Plus
U 3151297 U 2124007..2124064 1982..1925 275 98.3 Minus
U 3151297 U 2638959..2639007 2273..2321 245 100 Plus
U 3151297 U 2753001..2753038 2321..2284 190 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:40:34
Subject Length Description Subject Range Query Range Score Percent Strand
X 23527363 X 1758010..1759119 1111..1 5485 99.7 Minus
X 23527363 X 1753974..1754677 2321..1618 3520 100 Minus
X 23527363 X 21879459..21879858 1922..2321 2000 100 Plus
X 23527363 X 16238826..16239224 2321..1923 1995 100 Minus
2R 25260384 2R 9872293..9872691 1923..2321 1995 100 Plus
3L 28103327 3L 18773790..18774187 2321..1924 1990 100 Minus
3L 28103327 3L 18530489..18530886 2321..1924 1990 100 Minus
3L 28103327 3L 9271073..9271470 2321..1924 1990 100 Minus
3R 31820162 3R 8351351..8351748 2321..1924 1990 100 Minus
3R 31820162 3R 4115572..4115969 2321..1924 1990 100 Minus
X 23527363 X 168906..169303 1924..2321 1990 100 Plus
2R 25260384 2R 14468547..14468944 1924..2321 1990 100 Plus
2L 23513712 2L 6426910..6427307 1924..2321 1990 100 Plus
2L 23513712 2L 23342458..23342855 2321..1924 1990 100 Minus
2L 23513712 2L 23092571..23092968 2321..1924 1990 100 Minus
3L 28103327 3L 9494856..9495252 1925..2321 1985 100 Plus
3L 28103327 3L 7918669..7919065 1925..2321 1985 100 Plus
3L 28103327 3L 7909984..7910380 1925..2321 1985 100 Plus
3L 28103327 3L 6424792..6425188 1925..2321 1985 100 Plus
3L 28103327 3L 6398814..6399210 1925..2321 1985 100 Plus
3L 28103327 3L 789969..790365 1925..2321 1985 100 Plus
3L 28103327 3L 24851788..24852184 2321..1925 1985 100 Minus
3L 28103327 3L 24013447..24013843 2321..1925 1985 100 Minus
3L 28103327 3L 24005592..24005988 2321..1925 1985 100 Minus
3L 28103327 3L 19850392..19850788 2321..1925 1985 100 Minus
3L 28103327 3L 19841688..19842084 2321..1925 1985 100 Minus
3L 28103327 3L 18765595..18765991 2321..1925 1985 100 Minus
3L 28103327 3L 18521814..18522210 2321..1925 1985 100 Minus
3L 28103327 3L 13813056..13813452 2321..1925 1985 100 Minus
3L 28103327 3L 11500916..11501312 2321..1925 1985 100 Minus
3L 28103327 3L 11492243..11492639 2321..1925 1985 100 Minus
3L 28103327 3L 9263804..9264200 2321..1925 1985 100 Minus
3L 28103327 3L 8483632..8484028 2321..1925 1985 100 Minus
3L 28103327 3L 8474959..8475355 2321..1925 1985 100 Minus
3L 28103327 3L 118979..119375 2321..1925 1985 100 Minus
3L 28103327 3L 110298..110694 2321..1925 1985 100 Minus
3R 31820162 3R 30144884..30145280 1925..2321 1985 100 Plus
3R 31820162 3R 30137104..30137500 1925..2321 1985 100 Plus
3R 31820162 3R 27270767..27271163 1925..2321 1985 100 Plus
3R 31820162 3R 27262044..27262440 1925..2321 1985 100 Plus
3R 31820162 3R 26259963..26260359 1925..2321 1985 100 Plus
3R 31820162 3R 26251388..26251784 1925..2321 1985 100 Plus
3R 31820162 3R 25582273..25582669 1925..2321 1985 100 Plus
3R 31820162 3R 25573577..25573973 1925..2321 1985 100 Plus
3R 31820162 3R 23584955..23585351 1925..2321 1985 100 Plus
3R 31820162 3R 23576290..23576686 1925..2321 1985 100 Plus
3R 31820162 3R 8152574..8152970 1925..2321 1985 100 Plus
3R 31820162 3R 8143894..8144290 1925..2321 1985 100 Plus
3R 31820162 3R 26551470..26551866 2321..1925 1985 100 Minus
3R 31820162 3R 21988983..21989379 2321..1925 1985 100 Minus
3R 31820162 3R 21980409..21980805 2321..1925 1985 100 Minus
3R 31820162 3R 17504080..17504476 2321..1925 1985 100 Minus
3R 31820162 3R 8342684..8343080 2321..1925 1985 100 Minus
3R 31820162 3R 4107675..4108071 2321..1925 1985 100 Minus
3R 31820162 3R 1849519..1849915 2321..1925 1985 100 Minus
X 23527363 X 8963936..8964332 1925..2321 1985 100 Plus
X 23527363 X 8956912..8957308 1925..2321 1985 100 Plus
X 23527363 X 3618270..3618666 1925..2321 1985 100 Plus
X 23527363 X 3605704..3606100 1925..2321 1985 100 Plus
X 23527363 X 1080217..1080613 1925..2321 1985 100 Plus
X 23527363 X 1071909..1072305 1925..2321 1985 100 Plus
X 23527363 X 175675..176071 1925..2321 1985 100 Plus
X 23527363 X 1745295..1745691 2321..1925 1985 100 Minus
X 23527363 X 21535488..21535884 2321..1925 1985 100 Minus
X 23527363 X 21529396..21529792 2321..1925 1985 100 Minus
X 23527363 X 18973431..18973827 2321..1925 1985 100 Minus
X 23527363 X 18965254..18965650 2321..1925 1985 100 Minus
X 23527363 X 16357523..16357919 2321..1925 1985 100 Minus
X 23527363 X 16348852..16349248 2321..1925 1985 100 Minus
X 23527363 X 16230962..16231358 2321..1925 1985 100 Minus
X 23527363 X 4797697..4798093 2321..1925 1985 100 Minus
X 23527363 X 3622211..3622607 2321..1925 1985 100 Minus
X 23527363 X 3609643..3610039 2321..1925 1985 100 Minus
X 23527363 X 3235353..3235749 2321..1925 1985 100 Minus
X 23527363 X 3226690..3227086 2321..1925 1985 100 Minus
X 23527363 X 2840034..2840430 2321..1925 1985 100 Minus
X 23527363 X 2831972..2832368 2321..1925 1985 100 Minus
2R 25260384 2R 25160109..25160505 1925..2321 1985 100 Plus
2R 25260384 2R 25142905..25143301 1925..2321 1985 100 Plus
2R 25260384 2R 24362559..24362955 1925..2321 1985 100 Plus
2R 25260384 2R 21748206..21748602 1925..2321 1985 100 Plus
2R 25260384 2R 21739532..21739928 1925..2321 1985 100 Plus
2R 25260384 2R 18600787..18601183 1925..2321 1985 100 Plus
2R 25260384 2R 18592122..18592518 1925..2321 1985 100 Plus
2R 25260384 2R 14477214..14477610 1925..2321 1985 100 Plus
2R 25260384 2R 9213948..9214344 1925..2321 1985 100 Plus
2R 25260384 2R 8332117..8332513 1925..2321 1985 100 Plus
2R 25260384 2R 4115633..4116029 1925..2321 1985 100 Plus
2R 25260384 2R 4106947..4107343 1925..2321 1985 100 Plus
2R 25260384 2R 18372052..18372448 2321..1925 1985 100 Minus
2R 25260384 2R 18363368..18363764 2321..1925 1985 100 Minus
2R 25260384 2R 14110385..14110781 2321..1925 1985 100 Minus
2R 25260384 2R 14094720..14095116 2321..1925 1985 100 Minus
2R 25260384 2R 12798457..12798853 2321..1925 1985 100 Minus
2R 25260384 2R 12790580..12790976 2321..1925 1985 100 Minus
2R 25260384 2R 10186846..10187242 2321..1925 1985 100 Minus
2R 25260384 2R 10178165..10178561 2321..1925 1985 100 Minus
2L 23513712 2L 21449803..21450199 1925..2321 1985 100 Plus
2L 23513712 2L 21441096..21441492 1925..2321 1985 100 Plus
2L 23513712 2L 18060606..18061002 1925..2321 1985 100 Plus
2L 23513712 2L 18051931..18052327 1925..2321 1985 100 Plus
2L 23513712 2L 10955728..10956124 1925..2321 1985 100 Plus
2L 23513712 2L 10946999..10947395 1925..2321 1985 100 Plus
2L 23513712 2L 7350011..7350407 1925..2321 1985 100 Plus
2L 23513712 2L 7343381..7343777 1925..2321 1985 100 Plus
2L 23513712 2L 6444685..6445081 1925..2321 1985 100 Plus
2L 23513712 2L 21990447..21990843 2321..1925 1985 100 Minus
2L 23513712 2L 21981769..21982165 2321..1925 1985 100 Minus
2L 23513712 2L 21569827..21570223 2321..1925 1985 100 Minus
2L 23513712 2L 21560824..21561220 2321..1925 1985 100 Minus
2L 23513712 2L 14651334..14651730 2321..1925 1985 100 Minus
2L 23513712 2L 14642657..14643053 2321..1925 1985 100 Minus
2L 23513712 2L 9007390..9007786 2321..1925 1985 100 Minus
2L 23513712 2L 9000366..9000762 2321..1925 1985 100 Minus
2L 23513712 2L 6431595..6431991 2321..1925 1985 100 Minus
Y 3410481 Y 770466..770862 1925..2321 1985 100 Plus
Unmapped_scaffold_18 34521 Unmapped_scaffold_18 29951..30347 2321..1925 1985 100 Minus
3L 28103327 3L 18040861..18041259 1923..2321 1980 99.7 Plus
2R 25260384 2R 11019788..11020186 2321..1923 1980 99.7 Minus
3L 28103327 3L 6214069..6214466 1924..2321 1975 99.7 Plus
3L 28103327 3L 5042911..5043308 2321..1924 1975 99.7 Minus
3L 28103327 3L 14289168..14289568 2322..1922 1975 99.5 Minus
3R 31820162 3R 28499171..28499568 1924..2321 1975 99.7 Plus
3R 31820162 3R 13935313..13935710 1924..2321 1975 99.7 Plus
3R 31820162 3R 1452813..1453210 1924..2321 1975 99.7 Plus
3R 31820162 3R 31637091..31637488 2321..1924 1975 99.7 Minus
X 23527363 X 22981454..22981851 1924..2321 1975 99.7 Plus
X 23527363 X 2407990..2408387 1924..2321 1975 99.7 Plus
X 23527363 X 5004956..5005353 2321..1924 1975 99.7 Minus
2R 25260384 2R 9491407..9491804 2321..1924 1975 99.7 Minus
3L 28103327 3L 21307976..21308372 1925..2321 1970 99.7 Plus
3L 28103327 3L 21299303..21299699 1925..2321 1970 99.7 Plus
3L 28103327 3L 18049434..18049830 1925..2321 1970 99.7 Plus
3L 28103327 3L 13797701..13798097 1925..2321 1970 99.7 Plus
3L 28103327 3L 9931116..9931512 1925..2321 1970 99.7 Plus
3L 28103327 3L 9922823..9923219 1925..2321 1970 99.7 Plus
3L 28103327 3L 6887679..6888075 1925..2321 1970 99.7 Plus
3L 28103327 3L 6416142..6416538 1925..2321 1970 99.7 Plus
3L 28103327 3L 6407486..6407882 1925..2321 1970 99.7 Plus
3L 28103327 3L 6222736..6223132 1925..2321 1970 99.7 Plus
3L 28103327 3L 2456230..2456626 1925..2321 1970 99.7 Plus
3L 28103327 3L 2447560..2447956 1925..2321 1970 99.7 Plus
3L 28103327 3L 20115615..20116011 2321..1925 1970 99.7 Minus
3L 28103327 3L 13804366..13804762 2321..1925 1970 99.7 Minus
3L 28103327 3L 5034245..5034641 2321..1925 1970 99.7 Minus
3R 31820162 3R 29631577..29631973 1925..2321 1970 99.7 Plus
3R 31820162 3R 29622906..29623302 1925..2321 1970 99.7 Plus
3R 31820162 3R 28504303..28504699 1925..2321 1970 99.7 Plus
3R 31820162 3R 20071885..20072281 1925..2321 1970 99.7 Plus
3R 31820162 3R 19191062..19191458 1925..2321 1970 99.7 Plus
3R 31820162 3R 19182392..19182788 1925..2321 1970 99.7 Plus
3R 31820162 3R 13943978..13944374 1925..2321 1970 99.7 Plus
3R 31820162 3R 12605448..12605844 1925..2321 1970 99.7 Plus
3R 31820162 3R 1461484..1461880 1925..2321 1970 99.7 Plus
3R 31820162 3R 31629757..31630153 2321..1925 1970 99.7 Minus
3R 31820162 3R 25475420..25475816 2321..1925 1970 99.7 Minus
3R 31820162 3R 25466746..25467142 2321..1925 1970 99.7 Minus
3R 31820162 3R 19906292..19906688 2321..1925 1970 99.7 Minus
3R 31820162 3R 19897608..19898004 2321..1925 1970 99.7 Minus
X 23527363 X 22988203..22988599 1925..2321 1970 99.7 Plus
X 23527363 X 21888333..21888729 1925..2321 1970 99.7 Plus
X 23527363 X 20828990..20829386 1925..2321 1970 99.7 Plus
X 23527363 X 20821873..20822269 1925..2321 1970 99.7 Plus
X 23527363 X 14953784..14954180 1925..2321 1970 99.7 Plus
X 23527363 X 14945013..14945409 1925..2321 1970 99.7 Plus
X 23527363 X 11751720..11752116 1925..2321 1970 99.7 Plus
X 23527363 X 7142072..7142468 1925..2321 1970 99.7 Plus
X 23527363 X 7133399..7133795 1925..2321 1970 99.7 Plus
X 23527363 X 2415858..2416254 1925..2321 1970 99.7 Plus
X 23527363 X 21047042..21047438 2321..1925 1970 99.7 Minus
X 23527363 X 10698886..10699282 2321..1925 1970 99.7 Minus
X 23527363 X 10694235..10694631 2321..1925 1970 99.7 Minus
X 23527363 X 4998228..4998624 2321..1925 1970 99.7 Minus
X 23527363 X 3509949..3510345 2321..1925 1970 99.7 Minus
X 23527363 X 3501276..3501672 2321..1925 1970 99.7 Minus
2R 25260384 2R 20378443..20378839 1925..2321 1970 99.7 Plus
2R 25260384 2R 20369766..20370162 1925..2321 1970 99.7 Plus
2R 25260384 2R 11011100..11011496 2321..1925 1970 99.7 Minus
2R 25260384 2R 9481362..9481758 2321..1925 1970 99.7 Minus
2R 25260384 2R 2421013..2421409 2321..1925 1970 99.7 Minus
2R 25260384 2R 2417776..2418172 2321..1925 1970 99.7 Minus
2R 25260384 2R 2409113..2409509 2321..1925 1970 99.7 Minus
2L 23513712 2L 23414397..23414793 1925..2321 1970 99.7 Plus
2L 23513712 2L 23367806..23368202 1925..2321 1970 99.7 Plus
2L 23513712 2L 23359134..23359530 1925..2321 1970 99.7 Plus
2L 23513712 2L 21604343..21604739 1925..2321 1970 99.7 Plus
2L 23513712 2L 21597085..21597481 1925..2321 1970 99.7 Plus
2L 23513712 2L 19673576..19673972 1925..2321 1970 99.7 Plus
2L 23513712 2L 19652628..19653024 1925..2321 1970 99.7 Plus
2L 23513712 2L 6436014..6436410 1925..2321 1970 99.7 Plus
2L 23513712 2L 22614355..22614751 2321..1925 1970 99.7 Minus
2L 23513712 2L 22605697..22606093 2321..1925 1970 99.7 Minus
2L 23513712 2L 19712273..19712669 2321..1925 1970 99.7 Minus
2L 23513712 2L 19703623..19704019 2321..1925 1970 99.7 Minus
2L 23513712 2L 13853171..13853567 2321..1925 1970 99.7 Minus
2L 23513712 2L 5836316..5836712 2321..1925 1970 99.7 Minus
2L 23513712 2L 5827794..5828190 2321..1925 1970 99.7 Minus
2R 25260384 2R 21754336..21754734 1923..2321 1965 99.4 Plus
3L 28103327 3L 15931044..15931441 2321..1924 1960 99.4 Minus
2R 25260384 2R 21810778..21811175 1924..2321 1960 99.4 Plus
3L 28103327 3L 13525622..13526018 1925..2321 1955 99.4 Plus
3L 28103327 3L 13518312..13518708 1925..2321 1955 99.4 Plus
3L 28103327 3L 27808148..27808546 1924..2321 1955 99.7 Plus
3L 28103327 3L 15922383..15922779 2321..1925 1955 99.4 Minus
3R 31820162 3R 26756940..26757336 1925..2321 1955 99.4 Plus
3R 31820162 3R 26748291..26748687 1925..2321 1955 99.4 Plus
3R 31820162 3R 23425583..23425979 1925..2321 1955 99.4 Plus
3R 31820162 3R 17379204..17379600 1925..2321 1955 99.4 Plus
3R 31820162 3R 11120153..11120549 2321..1925 1955 99.4 Minus
X 23527363 X 843061..843457 1925..2321 1955 99.4 Plus
X 23527363 X 835755..836151 1925..2321 1955 99.4 Plus
X 23527363 X 10284151..10284547 2321..1925 1955 99.4 Minus
X 23527363 X 10275487..10275883 2321..1925 1955 99.4 Minus
2R 25260384 2R 21818533..21818929 1925..2321 1955 99.4 Plus
2R 25260384 2R 12716650..12717046 1925..2321 1955 99.4 Plus
2R 25260384 2R 12708770..12709166 1925..2321 1955 99.4 Plus
2R 25260384 2R 2507701..2508097 1925..2321 1955 99.4 Plus
2R 25260384 2R 2499040..2499436 1925..2321 1955 99.4 Plus
2L 23513712 2L 984085..984481 1925..2321 1955 99.4 Plus
2L 23513712 2L 976935..977331 1925..2321 1955 99.4 Plus
2L 23513712 2L 1005420..1005816 2321..1925 1955 99.4 Minus
2L 23513712 2L 996811..997207 2321..1925 1955 99.4 Minus
2L 23513712 2L 695559..695955 2321..1925 1955 99.4 Minus
2L 23513712 2L 687005..687401 2321..1925 1955 99.4 Minus
3L 28103327 3L 27816785..27817182 1925..2321 1950 99.7 Plus
3L 28103327 3L 27507696..27508093 1925..2321 1950 99.7 Plus
3R 31820162 3R 26125915..26126312 2321..1925 1950 99.7 Minus
3R 31820162 3R 26117242..26117639 2321..1925 1950 99.7 Minus
2R 25260384 2R 24354683..24355080 1925..2321 1950 99.7 Plus
2L 23513712 2L 8461160..8461557 1925..2321 1950 99.7 Plus
2L 23513712 2L 8452476..8452873 1925..2321 1950 99.7 Plus
2L 23513712 2L 23405711..23406108 1924..2321 1945 99.2 Plus
3L 28103327 3L 6880672..6881070 1924..2321 1940 99.4 Plus
3R 31820162 3R 30065317..30065714 1925..2321 1935 99.4 Plus
3R 31820162 3R 30058212..30058609 1925..2321 1935 99.4 Plus
X 23527363 X 14121840..14122237 1925..2321 1935 99.4 Plus
2R 25260384 2R 12483739..12484136 2321..1925 1935 99.4 Minus
2R 25260384 2R 12482422..12482819 2321..1925 1935 99.4 Minus
2R 25260384 2R 9362172..9362569 2321..1925 1935 99.4 Minus
2R 25260384 2R 9353510..9353907 2321..1925 1935 99.4 Minus
2R 25260384 2R 7218387..7218784 2321..1925 1935 99.4 Minus
2R 25260384 2R 7211126..7211523 2321..1925 1935 99.4 Minus
2L 23513712 2L 2109125..2109522 2321..1925 1935 99.4 Minus
2L 23513712 2L 2100461..2100858 2321..1925 1935 99.4 Minus
2L 23513712 2L 21403091..21403490 1925..2321 1930 99.2 Plus
3R 31820162 3R 11128821..11129219 2321..1924 1925 99.2 Minus
2L 23513712 2L 13861834..13862231 2321..1925 1920 99.2 Minus
2R 25260384 2R 25150542..25150938 1925..2321 1910 98.7 Plus
2R 25260384 2R 4552234..4552631 2321..1925 1860 98.2 Minus
3R 31820162 3R 2331798..2332193 2321..1925 1840 97.9 Minus
2L 23513712 2L 22918836..22919231 1925..2321 1840 97.9 Plus
Unmapped_scaffold_62 167859 Unmapped_scaffold_62 17275..17670 1925..2321 1840 97.9 Plus
2R 25260384 2R 2593784..2594179 1925..2321 1825 97.7 Plus
2R 25260384 2R 2591830..2592225 1925..2321 1825 97.7 Plus
Unmapped_scaffold_62 167859 Unmapped_scaffold_62 8792..9187 1925..2321 1825 97.7 Plus
Unmapped_scaffold_01 76224 Unmapped_scaffold_01 26228..26623 1925..2321 1825 97.7 Plus
3R 31820162 3R 81404..81800 1924..2321 1800 97.2 Plus
2R 25260384 2R 2588312..2588707 2321..1925 1780 96.9 Minus
Y 3410481 Y 3015418..3015813 1925..2321 1780 96.9 Plus
Y 3410481 Y 2980106..2980501 2321..1925 1780 96.9 Minus
Unmapped_scaffold_01 76224 Unmapped_scaffold_01 46191..46586 1925..2321 1780 96.9 Plus
Unmapped_scaffold_23 31460 Unmapped_scaffold_23 26889..27286 1925..2321 1770 96.7 Plus
Unmapped_scaffold_23 31460 Unmapped_scaffold_23 1591..1988 1925..2321 1770 96.7 Plus
2R 25260384 2R 2798401..2798758 1961..2321 1530 95.8 Plus
2L 23513712 2L 23504137..23504415 2043..2321 1305 97.8 Plus
Unmapped_scaffold_23 31460 Unmapped_scaffold_23 10395..10669 1925..2199 1270 97.4 Plus
Y 3410481 Y 1562672..1562952 1925..2206 1265 97.1 Plus
Y 3410481 Y 1565209..1565489 2206..1925 1265 97.1 Minus
Y 3410481 Y 587137..587366 2321..2092 1045 96.9 Minus
Y 3410481 Y 582118..582347 2321..2092 1045 96.9 Minus
Y 3410481 Y 582360..582499 2066..1927 595 95 Minus
Y 3410481 Y 587379..587518 2066..1927 595 95 Minus
Y 3410481 Y 1562949..1563048 2222..2321 470 98 Plus
Y 3410481 Y 1565113..1565212 2321..2222 470 98 Minus
Unmapped_scaffold_23 31460 Unmapped_scaffold_23 10668..10729 2206..2267 280 96.7 Plus
Blast to na_te.dros performed 2014-11-26 21:14:22
Subject Length Description Subject Range Query Range Score Percent Strand
roo 9092 roo DM_ROO 9092bp 8665..9059 1925..2319 1966 99.7 Plus
roo 9092 roo DM_ROO 9092bp 1..396 1925..2319 1941 99.2 Plus

MIP05434.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2014-11-26 22:31:17 Download gff for MIP05434.complete
Subject Subject Range Query Range Percent Splice Strand
chrX 1643749..1644858 1..1110 99   Minus
chrX 1643533..1643653 1111..1231 100 <- Minus
chrX 1641864..1642125 1232..1493 99 <- Minus
chrX 1640529..1640652 1494..1617 100 <- Minus
chrX 1640115..1640421 1618..1924 99 <- Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2009-10-19 18:05:57 Download gff for MIP05434.complete
Subject Subject Range Query Range Percent Splice Strand
Scgdelta-RA 1..491 610..1100 100 -> Plus
Scgdelta-RA 502..1215 1101..1806 98   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 21:35:22 Download gff for MIP05434.complete
Subject Subject Range Query Range Percent Splice Strand
Scgdelta-RD 502..1215 1101..1806 98   Plus
Scgdelta-RD 1..491 610..1100 100 -> Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 05:23:52 Download gff for MIP05434.complete
Subject Subject Range Query Range Percent Splice Strand
Scgdelta-RA 502..1215 1101..1806 98   Plus
Scgdelta-RA 1..491 610..1100 100 -> Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 22:31:17 Download gff for MIP05434.complete
Subject Subject Range Query Range Percent Splice Strand
Scgdelta-RC 502..1215 1101..1806 98   Plus
Scgdelta-RC 1..491 610..1100 100 -> Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2009-02-19 10:30:39 Download gff for MIP05434.complete
Subject Subject Range Query Range Percent Splice Strand
Scgdelta-RA 325..886 539..1100 100 -> Plus
Scgdelta-RA 897..1610 1101..1806 98   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 21:35:21 Download gff for MIP05434.complete
Subject Subject Range Query Range Percent Splice Strand
Scgdelta-RB 1..2318 1..2319 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 05:23:52 Download gff for MIP05434.complete
Subject Subject Range Query Range Percent Splice Strand
Scgdelta-RD 1110..2336 1101..2319 99   Plus
Scgdelta-RD 1..1099 1..1100 99 -> Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 22:31:17 Download gff for MIP05434.complete
Subject Subject Range Query Range Percent Splice Strand
Scgdelta-RD 1110..2336 1101..2319 99   Plus
Scgdelta-RD 1..1099 1..1100 99 -> Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 22:31:17 Download gff for MIP05434.complete
Subject Subject Range Query Range Percent Splice Strand
X 1749913..1751021 1..1110 99   Minus
X 1749697..1749817 1111..1231 100 <- Minus
X 1748032..1748293 1232..1493 100 <- Minus
X 1746687..1746810 1494..1617 100 <- Minus
X 1745878..1746579 1618..2319 100 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 05:23:52 Download gff for MIP05434.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 1643946..1645054 1..1110 99   Minus
arm_X 1643730..1643850 1111..1231 100 <- Minus
arm_X 1642065..1642326 1232..1493 100 <- Minus
arm_X 1640720..1640843 1494..1617 100 <- Minus
arm_X 1639911..1640612 1618..2319 100 <- Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 19:08:46 Download gff for MIP05434.complete
Subject Subject Range Query Range Percent Splice Strand
X 1758011..1759119 1..1110 99   Minus
X 1757795..1757915 1111..1231 100 <- Minus
X 1756130..1756391 1232..1493 100 <- Minus
X 1754785..1754908 1494..1617 100 <- Minus
X 1753976..1754677 1618..2319 100 <- Minus

MIP05434.pep Sequence

Translation from 609 to 1805

> MIP05434.pep
MLAAGSSEITDFGPHSRQLTAGNTPKRPNKASSHRPGSGSGPGPMTTGGT
SSASGNGNSGGALNAIPTTKVGSGGGGGGAMSATTVTATTGKATVSHGHS
HGHALGRSETRSGRSAAAGRSNVDGFVGGIETYLGLIGWRKKCLYTLLLL
LMLLIITNLVLTLWILKEGMGQLKIVPGGIQLSGQAIIMDMLRASTIRSR
HGQPISIESSRNFSINTRDPNGMIENHLFLGHDKFECLSAGFRINDTNGR
SLFSVNRDEVTIGAHALRIDGEGGAVFRESVQTPHVRAEPGRELRLESPT
RQLEMTAAKDINLQSRAGGIEVVALEDVKFRALDGSLRLESSKILMPNLR
TAQPPILGTAQSRDHMHRVFQLCACSNGKLFLAAPHSICAGDDSTVCR*

MIP05434.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2014-11-26 23:30:10
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF22006-PA 405 GF22006-PA 117..405 116..398 1353 93.8 Plus
Blast to dere-all-translation-r1.3.fasta performed 2014-11-26 23:30:12
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG12684-PA 402 GG12684-PA 1..402 1..398 1608 89.3 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2014-11-26 23:30:13
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH24442-PA 372 GH24442-PA 87..372 118..398 1244 87.5 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-26 23:30:09
Subject Length Description Subject Range Query Range Score Percent Strand
Scgdelta-PE 404 CG14808-PE 1..404 1..398 2030 98.5 Plus
Scgdelta-PD 404 CG14808-PD 1..404 1..398 2030 98.5 Plus
Scgdelta-PC 404 CG14808-PC 1..404 1..398 2030 98.5 Plus
Scgdelta-PA 404 CG14808-PA 1..404 1..398 2030 98.5 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2014-11-26 23:30:15
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI16029-PA 371 GI16029-PA 84..371 117..398 1267 86.5 Plus
Blast to dper-all-translation-r1.3.fasta performed 2014-11-26 23:30:17
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL14360-PA 429 GL14360-PA 38..429 19..398 1301 69.9 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2014-11-26 23:30:18
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA13263-PA 434 GA13263-PA 39..434 17..398 1302 69.2 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2014-11-26 23:30:20
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM18955-PA 332 GM18955-PA 1..289 1..295 1130 91 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2014-11-26 23:30:21
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD16416-PA 298 GD16416-PA 1..298 1..295 1215 94 Plus
Dsim\GD24628-PA 53 GD24628-PA 1..53 346..398 294 100 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2014-11-26 23:30:23
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ19465-PA 369 GJ19465-PA 39..369 68..398 1292 79.9 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2014-11-26 23:30:24
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK25303-PA 491 GK25303-PA 180..491 96..398 1344 86.2 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2014-11-26 23:30:26
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE16513-PA 405 GE16513-PA 1..405 1..398 1604 87.1 Plus

MIP05434.hyp Sequence

Translation from 609 to 1805

> MIP05434.hyp
MLAAGSSEITDFGPHSRQLTAGNTPKRPNKASSHRPGSGSGPGPMTTGGT
SSASGNGNSGGALNAIPTTKVGSGGGGGGAMSATTVTATTGKATVSHGHS
HGHALGRSETRSGRSAAAGRSNVDGFVGGIETYLGLIGWRKKCLYTLLLL
LMLLIITNLVLTLWILKEGMGQLKIVPGGIQLSGQAIIMDMLRASTIRSR
HGQPISIESSRNFSINTRDPNGMIENHLFLGHDKFECLSAGFRINDTNGR
SLFSVNRDEVTIGAHALRIDGEGGAVFRESVQTPHVRAEPGRELRLESPT
RQLEMTAAKDINLQSRAGGIEVVALEDVKFRALDGSLRLESSKILMPNLR
TAQPPILGTAQSRDHMHRVFQLCACSNGKLFLAAPHSICAGDDSTVCR*

MIP05434.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 14:04:01
Subject Length Description Subject Range Query Range Score Percent Strand
Scgdelta-PE 404 CG14808-PE 1..404 1..398 2030 98.5 Plus
Scgdelta-PD 404 CG14808-PD 1..404 1..398 2030 98.5 Plus
Scgdelta-PC 404 CG14808-PC 1..404 1..398 2030 98.5 Plus
Scgdelta-PA 404 CG14808-PA 1..404 1..398 2030 98.5 Plus