Clone MIP05442 Report

Search the DGRC for MIP05442

Clone and Library Details

Library:MIP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by:
Date Registered:2008-10-08
Comments:
Original Plate Number:54
Well:42
Vector:pOT2|pOTB7_DraIII
Associated Gene/TranscriptCG15629-RA
Protein status:MIP05442.pep: gold
Sequenced Size:1460

Clone Sequence Records

MIP05442.complete Sequence

1460 bp assembled on 2009-02-18

GenBank Submission: BT060448.1

> MIP05442.complete
AGTGGGGATTGTGAGTTCAGGCCAGACGGACGTGAGTGCTTAGGATCGCA
CTGAGTGCGAGTCGAAATCCGAGAAGAAACGAACATATAGGAAGACGGAG
AAATTCCAGCGAATTTCATTTGCATTCGAGCGGCGCGATTAAAAGTGAAC
AAATTGCGCAGGCCCAGTGCCATTTGTGTGGTGTGCCACAGCCCTAATCA
GCCATTCAAGCCGCGCATGCGCAGTGAATTTTAAAAATTAAATTTTCGAA
CCGAACCCCATTTGAAACCGCAGCGCACACGTGTGTCCCACGACGAATTG
AATTGCCAAGGGCGCGATATAAGCCAAAATAGTCATCATCATGACCGCCT
CACCGGGTCTTCTGCACATGGATCAACCGCTCAGAGCCATCTATCAATTC
TTACTCGACTTGCTAGTGTTTACGATTAAATCGGTGTACTACGTACTCGA
ATCGATTTACTACAGTCTGTTGCCGCAGCGCTTTCGAAAGTTAAAGGACA
TCTCCGGCCAGGTGGTGCTCATCACAGGAGGAGGCGGTGGTGTTGGACGT
TTGATTGCCCTAAACTTTGCTCGCCTTCAGGCCCGCATTGTCATCTGGGA
TATAAATCAAGAAGCCATAAAGACAACTGTGGATTTGTTGGCCAAACATG
GTTATGACAACTGCAAGGGCTACGTTGTGGACATCTCAGATCGGGAGCAG
ATCTACCAGCGTGCCAGCCAGGTGACCGAGGAGGTTGGTCCCGTCGACAT
ATTGATTAACAATGCCGGTATCGTGTGCTGCAAACCCTTCTGGGAGCTGC
ACGATCGGGTCATCCAGAACACGTACAACATTAACATCATATCGCACTAC
TGGACCGTGAAAGCGTTTCTGCCTCACATGATGCGCAATAATCGTGGTCA
TATCGTTACTGTGGGCTCGGTAACTGGAATGCTGGGCACCTACGGATGCA
GTGACTACGCGGCCACCAAATACGCCTGCATCGGTTTCCACGAGAGTTTG
CTCACCGATCTGAAGGCCCATGGCTATGATCAAATCCAAATGAGTTTGAT
CTGCCCGTACTACATCAACACGGGCATGTTTTCGGGTGTTCGGCCGCGGA
TGATGCCCATGCTGGAGCCGCAGTATGTGGCGGATCGCATCGAGAACGCC
GTGCGCTGCAACGAGGTGTGGTGCGTGCTGCCCAACTCTATTCGCCTGCT
CACTCCTCTCAAATGTCTTTTGCCCGCCAAAATGTGCTGGGAGCTGATGT
CGCGTGTCATCCGTGGACCCGAGTCTATGATGATGTTTCAGGGACGAGGG
CGCGTCGCCGCTGGTTAAACACACAATAGGAATCATCATATGGAATCCAT
TACCTAAGCTTAAGTTCTTTTTCAAGAGGCGGCATCGTTTCACCTATAAT
TTTACAATAAACTTAGTTATTTGATTTAACGAAAAAAAAAAAAAAAAAAA
AAAAAAAAAA

MIP05442.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 21:23:28
Subject Length Description Subject Range Query Range Score Percent Strand
CG15629-RA 1545 CG15629-RA 111..1543 1..1433 7150 99.9 Plus
CG3225.a 2365 CG3225.a 2113..2299 1401..1215 920 99.4 Minus
CG3225-RA 2480 CG3225-RA 2142..2320 1393..1215 895 100 Minus
CG3225-RA 2480 CG3225-RA 2376..2480 1215..1111 525 100 Minus
Blast to d_melanogaster_OreR.fa performed 2014-11-27 05:09:21
Subject Length Description Subject Range Query Range Score Percent Strand
chr2L 23010047 chr2L 4814141..4814743 613..1215 3015 100 Plus
chr2L 23010047 chr2L 4812138..4812634 1..497 2395 98.8 Plus
chr2L 23010047 chr2L 4814799..4815013 1215..1429 1075 100 Plus
chr2L 23010047 chr2L 4813888..4814007 495..614 585 99.2 Plus
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 05:09:17
Subject Length Description Subject Range Query Range Score Percent Strand
CG15629-RA 978 CG15629-PA 1..978 341..1318 4890 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 20:04:55 has no hits.
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 05:09:15
Subject Length Description Subject Range Query Range Score Percent Strand
CG15629-RA 1432 CG15629-RA 6..1432 1..1427 7135 100 Plus
CG3225-RA 2387 CG3225-RA 2143..2321 1393..1215 895 100 Minus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 05:09:19
Subject Length Description Subject Range Query Range Score Percent Strand
CG15629-PA 325 CG15629-PA 1..325 341..1315 1636 100 Plus
CG9265-PD 399 CG9265-PD 56..337 407..1261 521 39.6 Plus
CG9265-PC 399 CG9265-PC 56..337 407..1261 521 39.6 Plus
CG9265-PB 399 CG9265-PB 56..337 407..1261 521 39.6 Plus
CG9265-PA 399 CG9265-PA 56..337 407..1261 521 39.6 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 05:09:14
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 4815021..4815623 613..1215 3015 100 Plus
2L 23513712 2L 4813014..4813510 1..497 2485 100 Plus
2L 23513712 2L 4815679..4815897 1215..1433 1080 99.5 Plus
2L 23513712 2L 4814768..4814887 495..614 600 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:40:28
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 4815021..4815623 613..1215 3015 100 Plus
2L 23513712 2L 4813014..4813510 1..497 2485 100 Plus
2L 23513712 2L 4815679..4815897 1215..1433 1080 99.5 Plus
2L 23513712 2L 4814768..4814887 495..614 600 100 Plus
Blast to na_te.dros performed on 2014-11-27 05:09:15 has no hits.

MIP05442.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2014-11-27 06:26:56 Download gff for MIP05442.complete
Subject Subject Range Query Range Percent Splice Strand
chr2L 4814800..4815015 1216..1431 99   Plus
chr2L 4814143..4814743 615..1215 100 -> Plus
chr2L 4813890..4814007 497..614 99 -> Plus
chr2L 4812138..4812633 1..496 98 -> Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2009-10-19 18:05:53 Download gff for MIP05442.complete
Subject Subject Range Query Range Percent Splice Strand
CG15629-RA 1..978 341..1318 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 21:35:14 Download gff for MIP05442.complete
Subject Subject Range Query Range Percent Splice Strand
CG15629-RA 1..978 341..1318 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 08:21:08 Download gff for MIP05442.complete
Subject Subject Range Query Range Percent Splice Strand
CG15629-RA 1..978 341..1318 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 06:26:56 Download gff for MIP05442.complete
Subject Subject Range Query Range Percent Splice Strand
CG15629-RA 1..978 341..1318 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2009-02-18 18:04:00 Download gff for MIP05442.complete
Subject Subject Range Query Range Percent Splice Strand
CG15629-RA 1..1416 12..1427 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 21:35:13 Download gff for MIP05442.complete
Subject Subject Range Query Range Percent Splice Strand
CG15629-RA 1..1416 12..1427 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 08:21:08 Download gff for MIP05442.complete
Subject Subject Range Query Range Percent Splice Strand
CG15629-RA 6..1432 1..1427 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 06:26:56 Download gff for MIP05442.complete
Subject Subject Range Query Range Percent Splice Strand
CG15629-RA 6..1432 1..1427 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 06:26:56 Download gff for MIP05442.complete
Subject Subject Range Query Range Percent Splice Strand
2L 4815680..4815895 1216..1431 99   Plus
2L 4815023..4815623 615..1215 100 -> Plus
2L 4814770..4814887 497..614 100 -> Plus
2L 4813014..4813509 1..496 100 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 08:21:08 Download gff for MIP05442.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 4815680..4815895 1216..1431 99   Plus
arm_2L 4815023..4815623 615..1215 100 -> Plus
arm_2L 4814770..4814887 497..614 100 -> Plus
arm_2L 4813014..4813509 1..496 100 -> Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 19:08:35 Download gff for MIP05442.complete
Subject Subject Range Query Range Percent Splice Strand
2L 4815680..4815895 1216..1431 99   Plus
2L 4815023..4815623 615..1215 100 -> Plus
2L 4814770..4814887 497..614 100 -> Plus
2L 4813014..4813509 1..496 100 -> Plus

MIP05442.pep Sequence

Translation from 340 to 1317

> MIP05442.pep
MTASPGLLHMDQPLRAIYQFLLDLLVFTIKSVYYVLESIYYSLLPQRFRK
LKDISGQVVLITGGGGGVGRLIALNFARLQARIVIWDINQEAIKTTVDLL
AKHGYDNCKGYVVDISDREQIYQRASQVTEEVGPVDILINNAGIVCCKPF
WELHDRVIQNTYNINIISHYWTVKAFLPHMMRNNRGHIVTVGSVTGMLGT
YGCSDYAATKYACIGFHESLLTDLKAHGYDQIQMSLICPYYINTGMFSGV
RPRMMPMLEPQYVADRIENAVRCNEVWCVLPNSIRLLTPLKCLLPAKMCW
ELMSRVIRGPESMMMFQGRGRVAAG*

MIP05442.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2014-11-26 23:33:57
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF15490-PA 325 GF15490-PA 1..325 1..325 1622 92.9 Plus
Dana\GF24197-PA 404 GF24197-PA 55..341 18..307 583 38.6 Plus
Dana\GF20987-PA 323 GF20987-PA 41..305 33..297 400 33.8 Plus
Dana\GF18272-PA 363 GF18272-PA 48..342 11..301 373 33.4 Plus
Dana\GF23444-PA 300 GF23444-PA 6..300 7..315 345 29.5 Plus
Blast to dere-all-translation-r1.3.fasta performed 2014-11-26 23:33:58
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG25019-PA 325 GG25019-PA 1..325 1..325 1665 96.6 Plus
Dere\GG21531-PA 408 GG21531-PA 67..346 26..307 523 39.5 Plus
Dere\GG17587-PA 320 GG17587-PA 22..302 17..297 396 30.5 Plus
Dere\GG12468-PA 361 GG12468-PA 86..340 50..301 359 35 Plus
Dere\GG10276-PA 300 GG10276-PA 6..297 7..312 322 29.1 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2014-11-26 23:34:00
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH11705-PA 328 GH11705-PA 8..328 5..325 1533 88.8 Plus
Dgri\GH11338-PA 420 GH11338-PA 51..337 18..307 530 39.1 Plus
Dgri\GH24349-PA 325 GH24349-PA 56..266 49..259 357 34.9 Plus
Dgri\GH18214-PA 370 GH18214-PA 95..349 50..301 356 33.8 Plus
Dgri\GH10196-PA 300 GH10196-PA 6..297 7..312 351 31.6 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-26 23:33:55
Subject Length Description Subject Range Query Range Score Percent Strand
CG15629-PA 325 CG15629-PA 1..325 1..325 1722 100 Plus
CG9265-PD 399 CG9265-PD 56..337 23..307 580 39.6 Plus
CG9265-PC 399 CG9265-PC 56..337 23..307 580 39.6 Plus
CG9265-PB 399 CG9265-PB 56..337 23..307 580 39.6 Plus
CG9265-PA 399 CG9265-PA 56..337 23..307 580 39.6 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2014-11-26 23:34:02
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI16082-PA 327 GI16082-PA 3..327 2..325 1547 88.9 Plus
Dmoj\GI17845-PA 412 GI17845-PA 35..331 8..307 615 40.3 Plus
Dmoj\GI11003-PA 420 GI11003-PA 151..402 49..297 400 32.4 Plus
Dmoj\GI10764-PA 355 GI10764-PA 40..334 11..301 362 33.1 Plus
Dmoj\GI14832-PA 300 GI14832-PA 6..297 7..312 343 28.7 Plus
Blast to dper-all-translation-r1.3.fasta performed 2014-11-26 23:34:03
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL19368-PA 325 GL19368-PA 1..325 1..325 1616 92.9 Plus
Dper\GL25873-PA 425 GL25873-PA 57..349 12..307 546 39.4 Plus
Dper\GL26900-PA 323 GL26900-PA 58..305 53..297 388 32.5 Plus
Dper\GL27357-PA 363 GL27357-PA 88..342 50..301 352 33.8 Plus
Dper\GL14132-PA 303 GL14132-PA 44..303 42..315 339 31.1 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2014-11-26 23:34:05
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA13859-PA 325 GA13859-PA 1..325 1..325 1621 93.2 Plus
Dpse\GA21656-PA 425 GA21656-PA 57..349 12..307 546 39.4 Plus
Dpse\GA15325-PA 323 GA15325-PA 43..305 35..297 393 32.3 Plus
Dpse\GA14334-PA 363 GA14334-PA 88..342 50..301 352 33.8 Plus
Dpse\GA13373-PA 303 GA13373-PA 44..303 42..315 339 31.1 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2014-11-26 23:34:07
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM18492-PA 325 GM18492-PA 1..325 1..325 1722 98.2 Plus
Dsec\GM23287-PA 362 GM23287-PA 45..300 52..307 524 41.2 Plus
Dsec\GM11216-PA 318 GM11216-PA 4..300 1..297 406 29.9 Plus
Dsec\GM23599-PA 361 GM23599-PA 86..340 50..301 362 35 Plus
Dsec\GM26351-PA 300 GM26351-PA 6..297 7..312 322 28.8 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2014-11-26 23:34:09
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD23300-PA 325 GD23300-PA 1..325 1..325 1672 97.8 Plus
Dsim\GD21662-PA 362 GD21662-PA 45..300 52..307 524 41.2 Plus
Dsim\GD16132-PA 251 GD16132-PA 1..233 68..297 333 29.5 Plus
Dsim\GD22134-PA 300 GD22134-PA 6..300 7..315 320 28.5 Plus
Dsim\GD18413-PA 321 GD18413-PA 48..301 52..301 296 28.5 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2014-11-26 23:34:10
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ16192-PA 327 GJ16192-PA 7..327 5..325 1538 90 Plus
Dvir\GJ17339-PA 405 GJ17339-PA 44..336 12..307 557 39.5 Plus
Dvir\GJ15602-PA 328 GJ15602-PA 30..310 17..297 397 31.7 Plus
Dvir\GJ14365-PA 352 GJ14365-PA 77..331 50..301 357 34.2 Plus
Dvir\GJ23984-PA 300 GJ23984-PA 44..297 42..312 339 33.1 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2014-11-26 23:34:12
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK24179-PA 325 GK24179-PA 1..325 1..325 1576 90.8 Plus
Dwil\GK24717-PA 410 GK24717-PA 55..341 18..307 542 38.9 Plus
Dwil\GK25275-PA 332 GK25275-PA 34..289 17..272 432 36.5 Plus
Dwil\GK11607-PA 377 GK11607-PA 102..356 50..301 355 33.8 Plus
Dwil\GK21062-PA 300 GK21062-PA 6..297 7..312 350 29.7 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2014-11-26 23:34:13
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE18307-PA 325 GE18307-PA 1..325 1..325 1631 96.6 Plus
Dyak\GE13009-PA 399 GE13009-PA 45..337 12..307 538 39.1 Plus
Dyak\GE17487-PA 318 GE17487-PA 4..300 1..297 402 31.2 Plus
Dyak\GE23991-PA 361 GE23991-PA 86..340 50..301 362 35 Plus
Dyak\GE12446-PA 300 GE12446-PA 6..300 7..315 325 29.1 Plus

MIP05442.hyp Sequence

Translation from 340 to 1317

> MIP05442.hyp
MTASPGLLHMDQPLRAIYQFLLDLLVFTIKSVYYVLESIYYSLLPQRFRK
LKDISGQVVLITGGGGGVGRLIALNFARLQARIVIWDINQEAIKTTVDLL
AKHGYDNCKGYVVDISDREQIYQRASQVTEEVGPVDILINNAGIVCCKPF
WELHDRVIQNTYNINIISHYWTVKAFLPHMMRNNRGHIVTVGSVTGMLGT
YGCSDYAATKYACIGFHESLLTDLKAHGYDQIQMSLICPYYINTGMFSGV
RPRMMPMLEPQYVADRIENAVRCNEVWCVLPNSIRLLTPLKCLLPAKMCW
ELMSRVIRGPESMMMFQGRGRVAAG*

MIP05442.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 17:15:19
Subject Length Description Subject Range Query Range Score Percent Strand
CG15629-PA 325 CG15629-PA 1..325 1..325 1722 100 Plus
CG9265-PD 399 CG9265-PD 56..337 23..307 580 39.6 Plus
CG9265-PC 399 CG9265-PC 56..337 23..307 580 39.6 Plus
CG9265-PB 399 CG9265-PB 56..337 23..307 580 39.6 Plus
CG9265-PA 399 CG9265-PA 56..337 23..307 580 39.6 Plus