Clone MIP05512 Report

Search the DGRC for MIP05512

Clone and Library Details

Library:MIP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by:
Date Registered:2008-10-08
Comments:
Original Plate Number:55
Well:12
Vector:pOT2|pOTB7_DraIII
Associated Gene/TranscriptCG7335-RA
Protein status:MIP05512.pep: gold
Sequenced Size:1265

Clone Sequence Records

MIP05512.complete Sequence

1265 bp assembled on 2009-02-19

GenBank Submission: BT060449.1

> MIP05512.complete
ATTCAGAAGTTTCCACAATGAAAAAGCAAATCGTAAGGGAGTTCATAACC
GTAAAGAAGGTACTTCACCTGCCGCCGGAGCCACCCCCACCGCCGCCACC
TCCTAAGCGCCACGTTCTGGCTGTGGGCAGCTGCACCCTGGACATGATCA
CCATCGTGGATCTGCCTCTTTTTCCAGGCCAGGTGCAACGCACCACGGAG
GGAAGCTGGCGGCGCGGCGGTCCCGCTGCCAATATATGCACTGTGTGGCG
GCGACTGGGCTTGGAGTGCGAATTCCTCGGAGTTTTGAGCAGGGTTAGGG
CGTTCGAGAGCCTGTTGAATGGATTTCAATCGCAGGGAATCGACATTTCG
CATTGCCCGCTGACGAATCACCGGCCTGCGCACCGCAGCATCATTGTCCA
ACGTAACGTGGATACGCGAACCATGCTCGAGTTCGCCAATGCCAACCAGG
AGCTCACCTACCAGCAGTTTGTGGGCGCCGTGGACTACCAGAAGTACTCG
TGGATACACTTCGAATGTCGTAATCCCGTTGAGATGCTGCGCATGGTCCT
GGCGGTCATACAATTCAACGAGCGCTGCCCCGAGTCAAGGATCACACTCT
CTGTGGATCTGGACAACTTGCGACCGGCCACCATGTTGATGGCCAGTATG
GTGGACTACGTCTTCGCCCGAAAGACCATGATGCGTACGTACTGTTTTAT
GAATGGACGCGAGGTTGTTTGGGCGATTAGGAATGAAATGCGAAGAGCAC
GGACTCAATGGGAAAAAAGCCAGCCCAAAAAGATGCCCTATCTACCTCCT
GATCCCCCAGATGAGCATTCCAACGGATATTGCCCGGGACCGCTGAATAA
CCAACCCGTCGTCATATACAATAATTATATGGAAGGCGCCAGTTGCCTGA
TGGCCGACGACACCTACTTCAAGGTGGGCTCCCAGATTCCGCCCAAATTA
GTGGACGTTGTGGCCGTTAACGACACCTTCTCGGCGGCCGTGATATATGC
ACTGATTAAGGTCAAGATGCGGCTGAGGGATGCCATCGAGTACGGAACCC
GGGCGTCGTCTCTGAAGTTGACGGGAAACGGATTCGATGTGCTGCGGTGT
ATGCCCAAAGATCTGATTGGTTGTTACTATACTTAAGCCCATGGATTTAT
AATCATTGATTTTGTAAAATCTACTCTGTAAACTTGTACTAAGGTCACTT
AAAGGGAACTGGGTCAGCGACCCACTCATTTATCGTCGGTATCGAAAAAA
AAAAAAAAAAAAAAA

MIP05512.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 21:23:36
Subject Length Description Subject Range Query Range Score Percent Strand
CG7335-RA 1244 CG7335-RA 1..1244 1..1244 6220 100 Plus
Blast to d_melanogaster_OreR.fa performed 2014-11-27 14:12:40
Subject Length Description Subject Range Query Range Score Percent Strand
chr3L 24539361 chr3L 20121318..20122561 1244..1 6205 99.9 Minus
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 14:12:36
Subject Length Description Subject Range Query Range Score Percent Strand
CG7335-RA 1119 CG7335-PA 1..1119 18..1136 5595 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 20:05:07 has no hits.
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 14:12:35
Subject Length Description Subject Range Query Range Score Percent Strand
CG7335-RA 1237 CG7335-RA 1..1237 8..1244 6185 100 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 14:12:39
Subject Length Description Subject Range Query Range Score Percent Strand
CG7335-PA 372 CG7335-PA 1..372 18..1133 1810 100 Plus
CG7328-PA 306 CG7328-PA 5..297 108..1088 345 26.6 Plus
CG12289-PA 378 CG12289-PA 13..319 114..1118 321 27.1 Plus
CG7551-PB 322 CG7551-PB 14..311 105..1088 282 26.2 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 14:12:33
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 20132030..20133275 1246..1 6230 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:40:38
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28103327 3L 20125130..20126375 1246..1 6230 100 Minus
Blast to na_te.dros performed on 2014-11-27 14:12:34 has no hits.

MIP05512.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2014-11-27 16:07:27 Download gff for MIP05512.complete
Subject Subject Range Query Range Percent Splice Strand
chr3L 20121318..20122561 1..1244 99   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2009-10-19 18:06:00 Download gff for MIP05512.complete
Subject Subject Range Query Range Percent Splice Strand
CG7335-RA 1..1119 18..1136 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 21:35:27 Download gff for MIP05512.complete
Subject Subject Range Query Range Percent Splice Strand
CG7335-RA 1..1119 18..1136 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 17:47:41 Download gff for MIP05512.complete
Subject Subject Range Query Range Percent Splice Strand
CG7335-RA 1..1119 18..1136 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 16:07:27 Download gff for MIP05512.complete
Subject Subject Range Query Range Percent Splice Strand
CG7335-RA 1..1119 18..1136 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2009-02-19 12:56:17 Download gff for MIP05512.complete
Subject Subject Range Query Range Percent Splice Strand
CG7335-RA 1..1129 8..1136 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 21:35:27 Download gff for MIP05512.complete
Subject Subject Range Query Range Percent Splice Strand
CG7335-RA 1..1237 8..1244 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:47:41 Download gff for MIP05512.complete
Subject Subject Range Query Range Percent Splice Strand
CG7335-RA 1..1237 8..1244 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 16:07:27 Download gff for MIP05512.complete
Subject Subject Range Query Range Percent Splice Strand
CG7335-RA 1..1237 8..1244 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 16:07:27 Download gff for MIP05512.complete
Subject Subject Range Query Range Percent Splice Strand
3L 20132032..20133275 1..1244 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:47:41 Download gff for MIP05512.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 20125132..20126375 1..1244 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 19:08:52 Download gff for MIP05512.complete
Subject Subject Range Query Range Percent Splice Strand
3L 20125132..20126375 1..1244 100   Minus

MIP05512.pep Sequence

Translation from 2 to 1135

> MIP05512.pep
SEVSTMKKQIVREFITVKKVLHLPPEPPPPPPPPKRHVLAVGSCTLDMIT
IVDLPLFPGQVQRTTEGSWRRGGPAANICTVWRRLGLECEFLGVLSRVRA
FESLLNGFQSQGIDISHCPLTNHRPAHRSIIVQRNVDTRTMLEFANANQE
LTYQQFVGAVDYQKYSWIHFECRNPVEMLRMVLAVIQFNERCPESRITLS
VDLDNLRPATMLMASMVDYVFARKTMMRTYCFMNGREVVWAIRNEMRRAR
TQWEKSQPKKMPYLPPDPPDEHSNGYCPGPLNNQPVVIYNNYMEGASCLM
ADDTYFKVGSQIPPKLVDVVAVNDTFSAAVIYALIKVKMRLRDAIEYGTR
ASSLKLTGNGFDVLRCMPKDLIGCYYT*

MIP05512.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2014-11-26 23:28:25
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF24487-PA 373 GF24487-PA 1..373 6..377 1242 65.6 Plus
Dana\GF24486-PA 305 GF24486-PA 7..297 38..362 412 30.5 Plus
Dana\GF25264-PA 327 GF25264-PA 17..316 35..362 345 27.4 Plus
Dana\GF24552-PA 375 GF24552-PA 11..313 36..369 297 26.2 Plus
Blast to dere-all-translation-r1.3.fasta performed 2014-11-26 23:28:26
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG13342-PA 375 GG13342-PA 1..375 6..377 1832 93.1 Plus
Dere\GG13341-PA 306 GG13341-PA 5..297 36..362 342 27.5 Plus
Dere\GG13921-PA 381 GG13921-PA 11..319 36..372 323 26.3 Plus
Dere\GG15503-PA 322 GG15503-PA 14..311 35..362 311 27.7 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2014-11-26 23:28:28
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH15119-PA 374 GH15119-PA 1..373 6..376 987 53.9 Plus
Dgri\GH15118-PA 307 GH15118-PA 4..301 38..370 383 29.9 Plus
Dgri\GH16650-PA 379 GH16650-PA 13..314 38..364 314 26.5 Plus
Dgri\GH14844-PA 322 GH14844-PA 14..311 35..362 303 28.2 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-26 23:28:24
Subject Length Description Subject Range Query Range Score Percent Strand
CG7335-PA 372 CG7335-PA 1..372 6..377 1989 100 Plus
CG7328-PA 306 CG7328-PA 5..297 36..362 348 27.5 Plus
CG12289-PA 378 CG12289-PA 13..319 38..372 321 27.1 Plus
CG7551-PB 322 CG7551-PB 14..311 35..362 290 26.8 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2014-11-26 23:28:30
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI13771-PA 371 GI13771-PA 1..371 6..377 997 54.6 Plus
Dmoj\GI13769-PA 310 GI13769-PA 7..304 38..370 366 27.8 Plus
Dmoj\GI11611-PA 424 GI11611-PA 11..305 38..362 316 27.3 Plus
Dmoj\GI13697-PA 379 GI13697-PA 13..307 38..362 314 27.8 Plus
Dmoj\GI13699-PA 322 GI13699-PA 14..311 35..362 260 26.5 Plus
Blast to dper-all-translation-r1.3.fasta performed 2014-11-26 23:28:31
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL25058-PA 371 GL25058-PA 1..371 6..377 1167 59.3 Plus
Dper\GL25057-PA 310 GL25057-PA 10..302 38..362 358 29.5 Plus
Dper\GL22794-PA 302 GL22794-PA 24..291 67..362 274 27.2 Plus
Dper\GL22827-PA 192 GL22827-PA 6..176 31..201 195 31 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2014-11-26 23:28:33
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA20271-PA 371 GA20271-PA 1..371 6..377 1177 59.7 Plus
Dpse\GA20264-PA 310 GA20264-PA 10..302 38..362 356 29.5 Plus
Dpse\GA20433-PA 327 GA20433-PA 15..316 35..362 288 26.7 Plus
Dpse\GA23880-PA 394 GA23880-PA 7..309 32..362 263 24.6 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2014-11-26 23:28:34
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM22248-PA 372 GM22248-PA 1..372 6..377 1990 98.4 Plus
Dsec\GM22247-PA 306 GM22247-PA 3..297 34..362 360 26.4 Plus
Dsec\GM24754-PA 378 GM24754-PA 11..319 36..372 326 26.6 Plus
Dsec\GM25272-PA 322 GM25272-PA 14..311 35..362 299 26.8 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2014-11-26 23:28:35
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD12219-PA 183 GD12219-PA 1..170 6..175 830 97.6 Plus
Dsim\GD12218-PA 306 GD12218-PA 3..297 34..362 364 27.7 Plus
Dsim\GD12805-PA 378 GD12805-PA 11..319 36..372 323 26.3 Plus
Dsim\GD14306-PA 322 GD14306-PA 14..311 35..362 302 26.8 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2014-11-26 23:28:37
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ13760-PA 370 GJ13760-PA 1..370 6..377 1032 55.9 Plus
Dvir\GJ13759-PA 310 GJ13759-PA 7..303 38..369 378 28.7 Plus
Dvir\GJ11289-PA 420 GJ11289-PA 13..307 38..362 356 28.4 Plus
Dvir\GJ14039-PA 322 GJ14039-PA 14..311 35..362 307 28.7 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2014-11-26 23:28:39
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK17251-PA 698 GK17251-PA 1..374 6..371 1027 56.1 Plus
Dwil\GK17250-PA 308 GK17250-PA 7..300 38..362 381 29.8 Plus
Dwil\GK19276-PA 327 GK19276-PA 14..316 35..362 370 29.4 Plus
Dwil\GK17169-PA 418 GK17169-PA 13..309 38..362 358 28.5 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2014-11-26 23:28:40
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE22431-PA 375 GE22431-PA 1..375 6..377 1824 93.1 Plus
Dyak\GE23230-PA 330 GE23230-PA 1..330 48..377 1696 93.9 Plus
Dyak\GE22430-PA 306 GE22430-PA 5..297 36..362 353 27.7 Plus
Dyak\GE20217-PA 380 GE20217-PA 11..319 36..372 318 26.3 Plus
Dyak\GE21811-PA 322 GE21811-PA 14..311 35..362 303 27.6 Plus

MIP05512.hyp Sequence

Translation from 2 to 1135

> MIP05512.hyp
SEVSTMKKQIVREFITVKKVLHLPPEPPPPPPPPKRHVLAVGSCTLDMIT
IVDLPLFPGQVQRTTEGSWRRGGPAANICTVWRRLGLECEFLGVLSRVRA
FESLLNGFQSQGIDISHCPLTNHRPAHRSIIVQRNVDTRTMLEFANANQE
LTYQQFVGAVDYQKYSWIHFECRNPVEMLRMVLAVIQFNERCPESRITLS
VDLDNLRPATMLMASMVDYVFARKTMMRTYCFMNGREVVWAIRNEMRRAR
TQWEKSQPKKMPYLPPDPPDEHSNGYCPGPLNNQPVVIYNNYMEGASCLM
ADDTYFKVGSQIPPKLVDVVAVNDTFSAAVIYALIKVKMRLRDAIEYGTR
ASSLKLTGNGFDVLRCMPKDLIGCYYT*

MIP05512.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 15:47:15
Subject Length Description Subject Range Query Range Score Percent Strand
CG7335-PA 372 CG7335-PA 1..372 6..377 1989 100 Plus
CG7328-PA 306 CG7328-PA 5..297 36..362 348 27.5 Plus
CG12289-PA 378 CG12289-PA 13..319 38..372 321 27.1 Plus
CG7551-PB 322 CG7551-PB 14..311 35..362 290 26.8 Plus