Clone MIP05618 Report

Search the DGRC for MIP05618

Clone and Library Details

Library:MIP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by:
Date Registered:2008-10-08
Comments:
Original Plate Number:56
Well:18
Vector:pOT2|pOTB7_DraIII
Associated Gene/TranscriptSytalpha-RB
Protein status:MIP05618.pep: gold
Sequenced Size:1950

Clone Sequence Records

MIP05618.complete Sequence

1950 bp assembled on 2009-02-19

GenBank Submission: BT060450.1

> MIP05618.complete
TCTTTCGTGTGCAGCCACCGGTACTGGAGTGTCATTCATGCCTTGGATTG
TAATCGTTTTATAAATGACAACACATTCACTCTCAGCCGGAGAAATGGAC
ATTGTCATACGTGAGGAGGACATTTCTTTGGCCCAAATTGGCGTCTATGC
CTCTGTGTCCTTTCTCGTTGTTTCTGCAGTTGGGGCAGCGCTGTATACCA
CCTGCTCAAAACGCTATCGCCTGAACTGGTTCGAACAAAATCTCCTGGAG
TCCGCCAACGAAAAGGATGAAGATCAGCAAAGGGAGGCTTTGGTTGCCGG
TGCCGTGGGCTACAATGTGGACAACGTGAACGAGGTACCGCGTGGGAAAT
ACAGCAGCGGAAATGCCGGTAACCTCAGCCCCACCTCTCTGAAAAGCGAG
GACAATGACCCGGCCTTTTGGGTGCCGGCTTCAGTCACCTCCACGGCAGC
CATCCAGCAACAAGTGTCCAATACCACCGAGGAGTCCGCACCGCCAACAT
CACCCACCGGGAGCCTGAAGTCAAACACCTTGTCCTACTGTTCCACCACC
TCCGTGCCAATCGCGAGATCTGATAAGCATGTGGTCCTTGCTATGCATCC
GAGCCGTCCCAGAGTTTCCTCTATGAACGCCAAGCTGGATCACACCAAAA
TCGACATGACCTTGTATAGAAGTCATTCTCAGCCGAAGACTATCAATCCA
GTTTCACTCAACGAAGTTCGGGGTAATTTGCATGTGAGTCTTGGCTACGA
TCCAGTTGGAGGATTGCTAAATGTTCGACTCCTGGAGGCCCAGAATCTGC
AACCGAGGCAATTTAGTGGAACTGCCGACCCATATGCCAAAGTCCGCTTG
CTGCCGGATAAAAAGAACTTTTGGCAGACGCGTATACACAAGAGGACCCT
GAATCCAGTTTTCGACGAGCAGTTTGTTTTTGAGGTAACAGCCGGAGTAA
TTGACAAGCGTACTGTGGAAATTTTACTATACGACTTTGATGCTTATTCC
CGGCACGTTTGCATCGGAGGAAGTAAGCTACATTTGGCCAACTTGGATCT
CAGCGAGCAATTGAAGTTGTGGACTCCTCTTAGTTCTGCCTCGGCCCAAG
ATATGAAGGTGGATTTGGGCGATATAATGGTGTCCCTAGCCTATTTGCCA
TCAGCGGAGCGTTTGATGGTCGTCCTTATCAAGGCACGAAACCTGCGGAT
TGTCGACGATGCCCGGAACTCCTCGGACCCTTATGTAAAGGTAACCCTCC
TCGGTCCCGGTGGCAAAAAGATAAAGAAACGCAAGACGGGCGTTCAAAGG
GGCACCCTGAACCCAGTCTATAATGAGGCTCTTGCTTTCGATGTGGCCAA
GGAGACTTTAAAAAACTGTGTACTAGAATTCACCGTAGTCCACGATGGCC
TATTGGGATCAAGTGAAATATTAGGACGAACTCTCATTGGAAACTCTCCG
GAAGTACGCACCGAGGAAAAAATATTTTTTGAAGAAGTTTTTCGTGCCAA
AAATGCTACGGCTCAATGGGTTCCACTGCAAGAACCGGCAAACAATTTGG
CCACATCGGCCAAAAGTTCAAAGAACTAGAGTTTTGTATTATTGTAAAGG
TATTTTTTTCAGTATTTCCACAGATGTCATCCTTATTTCTAAGGATGTGT
GTGTACTCGGTTGCAGGCGATAAAAAAATACCAAAATATCCTTTTGCCTT
GTGTCTCAAAAGAGACATCGATGGTGGCTGTCTTGGATGCGTGTAGAAAT
GTGAATGAAGTGAATATCCAAACCTTTTTTGTGTTAGCACTGTCATGTTA
ATAACATTTAAAGATTCTGTAATGCGAAAGAACGAGCCACTTATTAAAAC
AAGAAATTATATATATTATTCTGTGTATATATACGCTTTAACGATCGGAA
GATAATATATTTAAAACTTCGTCAACTTTTCAAAAAAAAAAAAAAAAAAA

MIP05618.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 21:23:34
Subject Length Description Subject Range Query Range Score Percent Strand
Sytalpha.d 2285 Sytalpha.d 1..1931 1..1931 9655 100 Plus
Sytalpha.b 1931 Sytalpha.b 1..1931 1..1931 9655 100 Plus
Sytalpha.a 2282 Sytalpha.a 387..2243 75..1931 9285 100 Plus
Blast to d_melanogaster_OreR.fa performed 2014-11-26 23:17:28
Subject Length Description Subject Range Query Range Score Percent Strand
chr2L 23010047 chr2L 17601760..17602286 1406..1931 2555 99.4 Plus
chr2L 23010047 chr2L 17600848..17601349 906..1407 2480 99.6 Plus
chr2L 23010047 chr2L 17600090..17600488 281..673 1870 98.5 Plus
chr2L 23010047 chr2L 17600557..17600791 674..908 1175 100 Plus
chr2L 23010047 chr2L 17599580..17599788 75..283 1045 100 Plus
chr2L 23010047 chr2L 17590901..17590974 1..74 370 100 Plus
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 23:17:24
Subject Length Description Subject Range Query Range Score Percent Strand
Sytalpha-RB 1515 CG5559-PB 1..1515 65..1579 7575 100 Plus
Sytalpha-RC 1485 CG5559-PC 1..1485 95..1579 7425 100 Plus
Sytalpha-RA 1485 CG5559-PA 1..1485 95..1579 7425 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 20:05:14 has no hits.
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 23:17:23
Subject Length Description Subject Range Query Range Score Percent Strand
Sytalpha-RB 1931 CG5559-RB 1..1931 1..1931 9655 100 Plus
Sytalpha-RC 2189 CG5559-RC 333..2189 75..1931 9285 100 Plus
Sytalpha-RA 2037 CG5559-RA 181..2037 75..1931 9285 100 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-26 23:17:26
Subject Length Description Subject Range Query Range Score Percent Strand
Sytalpha-PB 504 CG5559-PB 1..504 65..1576 2466 100 Plus
Sytalpha-PC 494 CG5559-PC 1..494 95..1576 2416 100 Plus
Sytalpha-PA 494 CG5559-PA 1..494 95..1576 2416 100 Plus
Sytalpha-PD 494 CG5559-PD 1..494 95..1576 2416 100 Plus
Syt1-PI 472 CG3139-PI 192..461 722..1537 471 38 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 23:17:21
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 17603115..17603640 1406..1931 2630 100 Plus
2L 23513712 2L 17602203..17602704 906..1407 2510 100 Plus
2L 23513712 2L 17601451..17601843 281..673 1965 100 Plus
2L 23513712 2L 17601912..17602146 674..908 1175 100 Plus
2L 23513712 2L 17600941..17601149 75..283 1045 100 Plus
2L 23513712 2L 17592260..17592333 1..74 370 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:40:35
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 17603115..17603640 1406..1931 2630 100 Plus
2L 23513712 2L 17602203..17602704 906..1407 2510 100 Plus
2L 23513712 2L 17601451..17601843 281..673 1965 100 Plus
2L 23513712 2L 17601912..17602146 674..908 1175 100 Plus
2L 23513712 2L 17600941..17601149 75..283 1045 100 Plus
2L 23513712 2L 17592260..17592333 1..74 370 100 Plus
Blast to na_te.dros performed on 2014-11-26 23:17:22 has no hits.

MIP05618.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2014-11-27 01:27:29 Download gff for MIP05618.complete
Subject Subject Range Query Range Percent Splice Strand
chr2L 17601761..17602286 1407..1931 99   Plus
chr2L 17600851..17601348 909..1406 99 -> Plus
chr2L 17600557..17600791 674..908 100 -> Plus
chr2L 17600092..17600488 283..673 98 -> Plus
chr2L 17599580..17599787 75..282 100 -> Plus
chr2L 17590901..17590974 1..74 100 -> Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2010-07-28 16:33:40 Download gff for MIP05618.complete
Subject Subject Range Query Range Percent Splice Strand
CG5559-RA 1..1485 95..1579 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 21:35:23 Download gff for MIP05618.complete
Subject Subject Range Query Range Percent Splice Strand
Sytalpha-RB 1..1515 65..1579 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 06:36:22 Download gff for MIP05618.complete
Subject Subject Range Query Range Percent Splice Strand
Sytalpha-RB 1..1515 65..1579 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 01:27:29 Download gff for MIP05618.complete
Subject Subject Range Query Range Percent Splice Strand
Sytalpha-RB 1..1515 65..1579 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-07-28 16:33:39 Download gff for MIP05618.complete
Subject Subject Range Query Range Percent Splice Strand
CG5559-RA 174..1685 68..1579 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 21:35:23 Download gff for MIP05618.complete
Subject Subject Range Query Range Percent Splice Strand
Sytalpha-RB 1..1931 1..1931 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 06:36:22 Download gff for MIP05618.complete
Subject Subject Range Query Range Percent Splice Strand
Sytalpha-RB 1..1931 1..1931 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 01:27:29 Download gff for MIP05618.complete
Subject Subject Range Query Range Percent Splice Strand
Sytalpha-RB 1..1931 1..1931 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 01:27:29 Download gff for MIP05618.complete
Subject Subject Range Query Range Percent Splice Strand
2L 17603116..17603640 1407..1931 100   Plus
2L 17602206..17602703 909..1406 100 -> Plus
2L 17601912..17602146 674..908 100 -> Plus
2L 17601453..17601843 283..673 100 -> Plus
2L 17600941..17601148 75..282 100 -> Plus
2L 17592260..17592333 1..74 100 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 06:36:22 Download gff for MIP05618.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 17603116..17603640 1407..1931 100   Plus
arm_2L 17602206..17602703 909..1406 100 -> Plus
arm_2L 17601912..17602146 674..908 100 -> Plus
arm_2L 17601453..17601843 283..673 100 -> Plus
arm_2L 17600941..17601148 75..282 100 -> Plus
arm_2L 17592260..17592333 1..74 100 -> Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 19:08:47 Download gff for MIP05618.complete
Subject Subject Range Query Range Percent Splice Strand
2L 17603116..17603640 1407..1931 100   Plus
2L 17602206..17602703 909..1406 100 -> Plus
2L 17601912..17602146 674..908 100 -> Plus
2L 17601453..17601843 283..673 100 -> Plus
2L 17600941..17601148 75..282 100 -> Plus
2L 17592260..17592333 1..74 100 -> Plus

MIP05618.pep Sequence

Translation from 64 to 1578

> MIP05618.pep
MTTHSLSAGEMDIVIREEDISLAQIGVYASVSFLVVSAVGAALYTTCSKR
YRLNWFEQNLLESANEKDEDQQREALVAGAVGYNVDNVNEVPRGKYSSGN
AGNLSPTSLKSEDNDPAFWVPASVTSTAAIQQQVSNTTEESAPPTSPTGS
LKSNTLSYCSTTSVPIARSDKHVVLAMHPSRPRVSSMNAKLDHTKIDMTL
YRSHSQPKTINPVSLNEVRGNLHVSLGYDPVGGLLNVRLLEAQNLQPRQF
SGTADPYAKVRLLPDKKNFWQTRIHKRTLNPVFDEQFVFEVTAGVIDKRT
VEILLYDFDAYSRHVCIGGSKLHLANLDLSEQLKLWTPLSSASAQDMKVD
LGDIMVSLAYLPSAERLMVVLIKARNLRIVDDARNSSDPYVKVTLLGPGG
KKIKKRKTGVQRGTLNPVYNEALAFDVAKETLKNCVLEFTVVHDGLLGSS
EILGRTLIGNSPEVRTEEKIFFEEVFRAKNATAQWVPLQEPANNLATSAK
SSKN*

MIP05618.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2014-11-26 23:29:50
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF14804-PA 498 GF14804-PA 1..496 11..504 2536 94.6 Plus
Dana\GF13871-PA 474 GF13871-PA 194..463 220..491 439 38 Plus
Dana\GF20608-PA 416 GF20608-PA 149..410 220..485 434 36.9 Plus
Dana\GF10752-PA 611 GF10752-PA 331..607 200..485 322 32.5 Plus
Dana\GF17667-PA 481 GF17667-PA 238..481 255..490 321 34.1 Plus
Dana\GF17667-PA 481 GF17667-PA 325..445 208..318 191 37.2 Plus
Blast to dere-all-translation-r1.3.fasta performed 2014-11-26 23:29:52
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG21095-PA 496 GG21095-PA 1..496 11..504 2605 98.4 Plus
Dere\GG24490-PA 474 GG24490-PA 194..463 220..491 442 38 Plus
Dere\GG16453-PA 416 GG16453-PA 149..410 220..485 430 36.6 Plus
Dere\GG13697-PA 606 GG13697-PA 326..602 200..485 327 32.5 Plus
Dere\GG13974-PA 474 GG13974-PA 231..474 255..490 319 33.3 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2014-11-26 23:29:54
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH11627-PA 506 GH11627-PA 1..503 11..502 2177 83.8 Plus
Dgri\GH13767-PA 467 GH13767-PA 187..456 220..491 439 38 Plus
Dgri\GH23960-PA 417 GH23960-PA 150..411 220..485 433 36.9 Plus
Dgri\GH16678-PA 614 GH16678-PA 334..610 200..485 332 32.5 Plus
Dgri\GH18298-PA 473 GH18298-PA 230..473 255..490 320 33.3 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-26 23:29:49
Subject Length Description Subject Range Query Range Score Percent Strand
Sytalpha-PB 504 CG5559-PB 1..504 1..504 2565 100 Plus
Sytalpha-PC 494 CG5559-PC 1..494 11..504 2515 100 Plus
Sytalpha-PA 494 CG5559-PA 1..494 11..504 2515 100 Plus
Sytalpha-PD 494 CG5559-PD 1..494 11..504 2515 100 Plus
Syt1-PI 472 CG3139-PI 192..461 220..491 471 38 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2014-11-26 23:29:55
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI17929-PA 503 GI17929-PA 1..500 11..502 2335 88.4 Plus
Dmoj\GI17907-PA 468 GI17907-PA 188..457 220..491 440 38 Plus
Dmoj\GI14040-PA 415 GI14040-PA 148..409 220..485 432 36.9 Plus
Dmoj\GI11364-PA 606 GI11364-PA 326..602 200..485 330 32.2 Plus
Dmoj\GI24109-PA 471 GI24109-PA 228..471 255..490 318 34.1 Plus
Blast to dper-all-translation-r1.3.fasta performed 2014-11-26 23:29:56
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL16026-PA 235 GL16026-PA 69..235 203..391 515 60.9 Plus
Dper\GL26438-PA 473 GL26438-PA 193..462 220..491 440 38 Plus
Dper\GL18166-PA 414 GL18166-PA 147..408 220..485 431 36.6 Plus
Dper\GL25921-PA 609 GL25921-PA 329..605 200..485 324 32.5 Plus
Dper\GL12434-PA 482 GL12434-PA 239..482 255..490 315 32.9 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2014-11-26 23:29:58
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA18970-PA 569 GA18970-PA 80..567 11..504 2372 89.5 Plus
Dpse\GA16224-PA 473 GA16224-PA 193..462 220..491 440 38 Plus
Dpse\GA22513-PA 288 GA22513-PA 21..286 220..489 428 36.4 Plus
Dpse\GA15723-PA 610 GA15723-PA 330..606 200..485 324 32.5 Plus
Dpse\GA27501-PA 482 GA27501-PA 239..482 255..490 315 32.9 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2014-11-26 23:29:59
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM17249-PA 496 GM17249-PA 1..496 11..504 2613 99 Plus
Dsec\GM18197-PA 474 GM18197-PA 194..463 220..491 442 38 Plus
Dsec\GM26786-PA 416 GM26786-PA 149..410 220..485 423 36.2 Plus
Dsec\GM24517-PA 602 GM24517-PA 322..598 200..485 327 32.5 Plus
Dsec\GM10947-PA 470 GM10947-PA 61..470 106..490 322 28 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2014-11-26 23:30:01
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD12033-PA 510 GD12033-PA 346..510 340..504 832 97 Plus
Dsim\GD22802-PA 474 GD22802-PA 194..463 220..491 442 38 Plus
Dsim\GD12033-PA 510 GD12033-PA 1..91 11..102 427 90.2 Plus
Dsim\GD19926-PA 474 GD19926-PA 231..474 255..490 319 33.3 Plus
Dsim\GD17118-PA 787 GD17118-PA 480..707 217..441 255 31.4 Plus
Dsim\GD16016-PA 494 GD16016-PA 211..459 220..459 240 30.6 Plus
Dsim\GD19926-PA 474 GD19926-PA 318..438 208..318 187 37.2 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2014-11-26 23:30:02
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ17702-PA 501 GJ17702-PA 1..498 11..502 2348 88.6 Plus
Dvir\GJ17415-PA 467 GJ17415-PA 187..456 220..491 440 38 Plus
Dvir\GJ12969-PA 415 GJ12969-PA 148..409 220..485 433 36.9 Plus
Dvir\GJ11619-PA 600 GJ11619-PA 320..596 200..485 327 32.5 Plus
Dvir\GJ10932-PA 471 GJ10932-PA 228..471 255..490 320 34.1 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2014-11-26 23:30:04
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK18165-PA 494 GK18165-PA 1..481 11..495 2291 87.7 Plus
Dwil\GK18145-PA 474 GK18145-PA 194..463 220..491 443 38 Plus
Dwil\GK13680-PA 416 GK13680-PA 145..414 216..489 434 36.6 Plus
Dwil\GK17413-PA 594 GK17413-PA 314..590 200..485 336 32.9 Plus
Dwil\GK12005-PA 978 GK12005-PA 247..459 255..459 304 35.8 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2014-11-26 23:30:05
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE12800-PA 496 GE12800-PA 1..496 11..504 2593 97.6 Plus
Dyak\GE15027-PA 474 GE15027-PA 194..463 220..491 442 38 Plus
Dyak\GE14519-PA 416 GE14519-PA 149..410 220..485 431 36.6 Plus
Dyak\GE19992-PA 602 GE19992-PA 322..598 200..485 327 32.5 Plus
Dyak\GE24918-PA 826 GE24918-PA 92..335 255..490 310 32.9 Plus

MIP05618.hyp Sequence

Translation from 64 to 1578

> MIP05618.hyp
MTTHSLSAGEMDIVIREEDISLAQIGVYASVSFLVVSAVGAALYTTCSKR
YRLNWFEQNLLESANEKDEDQQREALVAGAVGYNVDNVNEVPRGKYSSGN
AGNLSPTSLKSEDNDPAFWVPASVTSTAAIQQQVSNTTEESAPPTSPTGS
LKSNTLSYCSTTSVPIARSDKHVVLAMHPSRPRVSSMNAKLDHTKIDMTL
YRSHSQPKTINPVSLNEVRGNLHVSLGYDPVGGLLNVRLLEAQNLQPRQF
SGTADPYAKVRLLPDKKNFWQTRIHKRTLNPVFDEQFVFEVTAGVIDKRT
VEILLYDFDAYSRHVCIGGSKLHLANLDLSEQLKLWTPLSSASAQDMKVD
LGDIMVSLAYLPSAERLMVVLIKARNLRIVDDARNSSDPYVKVTLLGPGG
KKIKKRKTGVQRGTLNPVYNEALAFDVAKETLKNCVLEFTVVHDGLLGSS
EILGRTLIGNSPEVRTEEKIFFEEVFRAKNATAQWVPLQEPANNLATSAK
SSKN*

MIP05618.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 14:12:05
Subject Length Description Subject Range Query Range Score Percent Strand
Sytalpha-PB 504 CG5559-PB 1..504 1..504 2565 100 Plus
Sytalpha-PC 494 CG5559-PC 1..494 11..504 2515 100 Plus
Sytalpha-PA 494 CG5559-PA 1..494 11..504 2515 100 Plus
Sytalpha-PD 494 CG5559-PD 1..494 11..504 2515 100 Plus
Syt1-PI 472 CG3139-PI 192..461 220..491 471 38 Plus