Clone MIP05841 Report

Search the DGRC for MIP05841

Clone and Library Details

Library:MIP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by:
Date Registered:2008-10-08
Comments:
Original Plate Number:58
Well:41
Vector:pOT2|pOTB7_DraIII
Associated Gene/TranscriptTdc2-RA
Protein status:MIP05841.pep: gold
Sequenced Size:2321

Clone Sequence Records

MIP05841.complete Sequence

2321 bp assembled on 2009-05-08

GenBank Submission: BT083414.1

> MIP05841.complete
TCGGGGCCAACGGTTCGTGGTCTCGAGTTCGAAACAAAATTCCCATTCGC
CCATCGGAATTTGCTCAGCACAACTCACCGTGGGAGTAAAAGAAAACGGA
AAAATAGGAAAACACTCAGAAAGGCGATTTGGAAAACCTACCGAAAATGG
ACAGCACCGAATTTCGAAAACGTGGCATGGAAATGGTGGAGTACATCTGC
AACTATCTGGAAACGCTGAACGAGCGACGGGTCACGCCCAGCGTGGAGCC
GGGATATTTGAGACACCTGTTGCCACCTGAGGCACCGCAGGAGCCGGAGG
ACTGGGACCAGATCATGAGGGACGTGGAGGACAAGATCATGCCCGGCGTG
ACGCATTGGCAGCATCCTCGCTTCCACGCCTATTTTCCGGCGGGCAACTC
GTTCCCCTCTATCCTGGGCGACATGTTGGGCGACGGGATCGGGTGCATCG
GCTTCTCCTGGGCCGCCAGTCCCGCGTGCACCGAGCTGGAGACCATAGTG
CTCGACTGGCTTGGCAAGGCCATCGGTCTGCCGGACCACTTTCTGGCCCT
CAAGGAGGGCAGCACCGGAGGGGGAGTCATCCAGACTTCCGCATCGGAGT
GCGTACTGGTCACGATGCTTGCTGCCAGGGCACAGGCGCTCAAGAGGCTC
AAGGCCCAGCACCCGTTTGTGGAGGAGGGTCACCTGCTGTCCAAGCTTAT
GGCCTACTGCTCCAAGGAGGCGCACAGCTGCGTGGAGAAAGCGGCGATGA
TCTGTTTCGTGAAGCTGCGCATTCTGGAGCCCGACGACGACGCCAGTCTG
CGCGGCCAGACGATCTACGAGGCAATGGAGGAGGACGAACTGCAGGGTCT
GGTGCCCTTCTTCGTCTCCACCACTCTGGGTACCACGGGCTCGTGTGCGT
TCGACAATCTGCCAGAGATCGGCAAGCAGTTGCAGCGATTCCCGGGCGTT
TGGCTGCACGTGGATGCCGCCTACGCGGGCAACAGCTTCATCTGCCCCGA
GCTGAAGCCGCTCCTGAAGGGCATCGAGTACGCCGACTCGTTCAACACCA
ATCCCAACAAATGGCTGCTGACGAACTTCGATTGCTCGACGCTGTGGGTG
CGGGACCGCATCCGGCTGACTTCAGCCCTGGTGGTGGATCCGCTGTACCT
GAAGCACGGCTACTCGGATGCGGCCATCGACTATCGTCATTGGGGAGTTC
CACTCAGTCGGCGTTTTCGTTCGCTGAAGCTGTGGTTCGTGCTGCGATCC
TATGGGATTTCCGGGCTGCAGCATTATATACGTCACCATATCAAGCTGGC
CAAGCGGTTCGAAGAGCTCGTGCTCAAAGATAAGCGCTTCGAGATCTGTA
ACCAAGTCAAGCTGGGCCTGGTCTGCTTTCGGCTGAAGGGTTCCGACAAG
CTGAATGAGAAGCTGCTGAGCATAATCAACGAGTCCGGCAAGCTGCACAT
GGTTCCGGCCAGCGTGGGCGATCGCTACATCATCAGGTTCTGCGCCGTGG
CCCAAAACGCGACCGCTGAGGACATTGACTACGCCTGGGACATCATCGTG
GACTTTGCCAACGAGTTGCTGGAGAAGGAGCAGCACGATGAGCTGTCCGA
GATCATGAACCGCAAGAAGCAGGACACGCTGGCCCAGAAGCGCTCATTCT
TCGTGCGCATGGTCAGCGATCCGAAGATCTACAACCCGGCGATCAACAAG
GCCGGCACTCCCAAGCTCTCAATGGAGCTGCCCTCGCCCGTTGTGAGCCG
CGGCAGTGCCCCCATTATCCGGACCCAGAGTTCGGTGGACCACAACTCGT
GGATATCCTGGCCGCTGGCATTCCTCTTCAACAGCAACAACGAGGAAAAG
GGCAGTAACGTCTCGTTGCGTTTCCGACACCTGGACACCAACGTACGACC
ATCGTCGTCGCGACGAAACTCCGGAGCCGGCTCGTCACCCTCTCCGGAAA
ACGAGTTGGACTACGTGAACGTCCAGCAGCAGCAGATGGAACAGCGATCG
CCACGACGATCGCCCATGGCGGTGCGCAAGGCATCGTCCACGCGGGACAA
CCTCAACTAATAATATTCACTCCGTTTATGGAACAACTATAATACAGTAT
TAGCGCTTCCTTAGGTCAGGCGCCTAGTTGAATTCTAGACCAATCTACAA
TGCGGTGGCATGCCACAGTAAAAGGCTTTTTCTGAATTCCAATATTGAAA
CTTTATAGAATACTATGAGTGCCGTGGCGAAAATATCAAACGAACATCTT
TCTTGTTTATGAATTGCAATAAATATTATTTCATAATAAAAAAAAAAAAA
AAAAAAAAAAAAAAAAAAAAA

MIP05841.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 16:25:55
Subject Length Description Subject Range Query Range Score Percent Strand
Tdc2-RA 2395 Tdc2-RA 126..2395 1..2270 11350 100 Plus
Tdc2.a 2623 Tdc2.a 354..2623 1..2270 11350 100 Plus
Hdc.a 3314 Hdc.a 603..661 477..535 175 86.4 Plus
Hdc.a 3314 Hdc.a 1329..1381 1206..1258 145 84.9 Plus
Blast to d_melanogaster_OreR.fa performed 2014-11-27 00:00:22
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 2572469..2572979 1870..1360 2555 100 Minus
chr2R 21145070 chr2R 2574605..2575044 1020..581 2200 100 Minus
chr2R 21145070 chr2R 2571943..2572360 2287..1870 2090 100 Minus
chr2R 21145070 chr2R 2575201..2575508 584..277 1540 100 Minus
chr2R 21145070 chr2R 2574335..2574553 1236..1018 1095 100 Minus
chr2R 21145070 chr2R 2575571..2575773 276..74 1000 99.5 Minus
chr2R 21145070 chr2R 2573858..2573985 1361..1234 640 100 Minus
chr2R 21145070 chr2R 2577084..2577156 73..1 365 100 Minus
chr2R 21145070 chr2R 2565433..2565514 1105..1024 230 85.4 Minus
chr2R 21145070 chr2R 6129422..6129582 375..535 190 74.5 Plus
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 00:00:17
Subject Length Description Subject Range Query Range Score Percent Strand
Tdc2-RA 1914 CG30446-PA 1..1914 147..2060 9570 100 Plus
Tdc1-RA 1764 CG30445-PA 875..956 1024..1105 230 85.4 Plus
Hdc-RD 2544 CG3454-PD 229..389 375..535 205 75.2 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 20:05:37 has no hits.
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 00:00:16
Subject Length Description Subject Range Query Range Score Percent Strand
Tdc2-RA 2303 CG30446-RA 17..2303 1..2287 11435 100 Plus
Tdc1-RA 2281 CG30445-RA 1087..1168 1024..1105 230 85.4 Plus
Hdc-RD 3733 CG3454-RD 920..1080 375..535 205 75.2 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 00:00:21
Subject Length Description Subject Range Query Range Score Percent Strand
Tdc2-PA 637 CG30446-PA 1..637 147..2057 3180 100 Plus
Tdc1-PA 587 CG30445-PA 1..482 147..1598 1407 55.4 Plus
Hdc-PC 619 CG3454-PC 1..476 147..1577 1368 55.1 Plus
Hdc-PD 847 CG3454-PD 1..476 147..1577 1368 55.1 Plus
Hdc-PB 847 CG3454-PB 1..476 147..1577 1368 55.1 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 00:00:13
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 6685271..6685781 1870..1360 2555 100 Minus
2R 25286936 2R 6687407..6687846 1020..581 2200 100 Minus
2R 25286936 2R 6684743..6685162 2289..1870 2100 100 Minus
2R 25286936 2R 6688003..6688310 584..277 1540 100 Minus
2R 25286936 2R 6687137..6687355 1236..1018 1095 100 Minus
2R 25286936 2R 6688373..6688575 276..74 1015 100 Minus
2R 25286936 2R 6686660..6686787 1361..1234 640 100 Minus
2R 25286936 2R 6689886..6689958 73..1 365 100 Minus
2R 25286936 2R 6678236..6678317 1105..1024 230 85.4 Minus
2R 25286936 2R 10241871..10242031 375..535 205 75.2 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 18:20:18
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 6686470..6686980 1870..1360 2555 100 Minus
2R 25260384 2R 6688606..6689045 1020..581 2200 100 Minus
2R 25260384 2R 6685942..6686361 2289..1870 2100 100 Minus
2R 25260384 2R 6689202..6689509 584..277 1540 100 Minus
2R 25260384 2R 6688336..6688554 1236..1018 1095 100 Minus
2R 25260384 2R 6689572..6689774 276..74 1015 100 Minus
2R 25260384 2R 6687859..6687986 1361..1234 640 100 Minus
2R 25260384 2R 6691085..6691157 73..1 365 100 Minus
2R 25260384 2R 6679435..6679516 1105..1024 230 85.3 Minus
2R 25260384 2R 10243172..10243230 477..535 175 86.4 Plus
2R 25260384 2R 10244638..10244690 1206..1258 145 84.9 Plus
Blast to na_te.dros performed on 2014-11-27 00:00:15 has no hits.

MIP05841.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2014-11-27 01:39:42 Download gff for MIP05841.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 2577084..2577156 1..73 100   Minus
chr2R 2575571..2575773 74..276 99 <- Minus
chr2R 2575201..2575508 277..584 100 <- Minus
chr2R 2574606..2575040 585..1019 100 <- Minus
chr2R 2574337..2574551 1020..1234 100 <- Minus
chr2R 2573858..2573984 1235..1361 100 <- Minus
chr2R 2572469..2572977 1362..1870 100 <- Minus
chr2R 2571943..2572359 1871..2287 100 <- Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2009-10-19 17:53:15 Download gff for MIP05841.complete
Subject Subject Range Query Range Percent Splice Strand
Tdc2-RA 1..1914 147..2060 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 13:51:32 Download gff for MIP05841.complete
Subject Subject Range Query Range Percent Splice Strand
Tdc2-RA 1..1914 147..2060 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 06:43:00 Download gff for MIP05841.complete
Subject Subject Range Query Range Percent Splice Strand
Tdc2-RA 1..1914 147..2060 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 01:39:42 Download gff for MIP05841.complete
Subject Subject Range Query Range Percent Splice Strand
Tdc2-RA 1..1914 147..2060 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2009-05-08 15:01:04 Download gff for MIP05841.complete
Subject Subject Range Query Range Percent Splice Strand
Tdc2-RA 5..2064 1..2060 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 13:51:32 Download gff for MIP05841.complete
Subject Subject Range Query Range Percent Splice Strand
Tdc2-RA 5..2291 1..2287 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 06:43:00 Download gff for MIP05841.complete
Subject Subject Range Query Range Percent Splice Strand
Tdc2-RA 17..2303 1..2287 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 01:39:42 Download gff for MIP05841.complete
Subject Subject Range Query Range Percent Splice Strand
Tdc2-RA 17..2303 1..2287 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 01:39:42 Download gff for MIP05841.complete
Subject Subject Range Query Range Percent Splice Strand
2R 6689886..6689958 1..73 100   Minus
2R 6688373..6688575 74..276 100 <- Minus
2R 6688003..6688310 277..584 100 <- Minus
2R 6687408..6687842 585..1019 100 <- Minus
2R 6687139..6687353 1020..1234 100 <- Minus
2R 6686660..6686786 1235..1361 100 <- Minus
2R 6685271..6685779 1362..1870 100 <- Minus
2R 6684745..6685161 1871..2287 100 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 06:43:00 Download gff for MIP05841.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 2577391..2577463 1..73 100   Minus
arm_2R 2575878..2576080 74..276 100 <- Minus
arm_2R 2575508..2575815 277..584 100 <- Minus
arm_2R 2574913..2575347 585..1019 100 <- Minus
arm_2R 2574644..2574858 1020..1234 100 <- Minus
arm_2R 2574165..2574291 1235..1361 100 <- Minus
arm_2R 2572776..2573284 1362..1870 100 <- Minus
arm_2R 2572250..2572666 1871..2287 100 <- Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 11:42:17 Download gff for MIP05841.complete
Subject Subject Range Query Range Percent Splice Strand
2R 6691085..6691157 1..73 100   Minus
2R 6689572..6689774 74..276 100 <- Minus
2R 6689202..6689509 277..584 100 <- Minus
2R 6688607..6689041 585..1019 100 <- Minus
2R 6688338..6688552 1020..1234 100 <- Minus
2R 6687859..6687985 1235..1361 100 <- Minus
2R 6686470..6686978 1362..1870 100 <- Minus
2R 6685944..6686360 1871..2287 100 <- Minus

MIP05841.pep Sequence

Translation from 146 to 2059

> MIP05841.pep
MDSTEFRKRGMEMVEYICNYLETLNERRVTPSVEPGYLRHLLPPEAPQEP
EDWDQIMRDVEDKIMPGVTHWQHPRFHAYFPAGNSFPSILGDMLGDGIGC
IGFSWAASPACTELETIVLDWLGKAIGLPDHFLALKEGSTGGGVIQTSAS
ECVLVTMLAARAQALKRLKAQHPFVEEGHLLSKLMAYCSKEAHSCVEKAA
MICFVKLRILEPDDDASLRGQTIYEAMEEDELQGLVPFFVSTTLGTTGSC
AFDNLPEIGKQLQRFPGVWLHVDAAYAGNSFICPELKPLLKGIEYADSFN
TNPNKWLLTNFDCSTLWVRDRIRLTSALVVDPLYLKHGYSDAAIDYRHWG
VPLSRRFRSLKLWFVLRSYGISGLQHYIRHHIKLAKRFEELVLKDKRFEI
CNQVKLGLVCFRLKGSDKLNEKLLSIINESGKLHMVPASVGDRYIIRFCA
VAQNATAEDIDYAWDIIVDFANELLEKEQHDELSEIMNRKKQDTLAQKRS
FFVRMVSDPKIYNPAINKAGTPKLSMELPSPVVSRGSAPIIRTQSSVDHN
SWISWPLAFLFNSNNEEKGSNVSLRFRHLDTNVRPSSSRRNSGAGSSPSP
ENELDYVNVQQQQMEQRSPRRSPMAVRKASSTRDNLN*

MIP05841.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2014-11-28 07:52:23
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF13800-PA 637 GF13800-PA 1..637 1..637 3304 96.9 Plus
Dana\GF13801-PA 600 GF13801-PA 1..477 1..479 1503 56.6 Plus
Dana\GF12784-PA 876 GF12784-PA 1..476 1..477 1459 54.7 Plus
Dana\GF15210-PA 510 GF15210-PA 36..510 1..479 1361 51.8 Plus
Dana\GF14702-PA 508 GF14702-PA 1..502 1..508 1213 44.9 Plus
Blast to dere-all-translation-r1.3.fasta performed 2014-11-28 07:52:25
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG10812-PA 637 GG10812-PA 1..637 1..637 3426 99.5 Plus
Dere\GG10813-PA 587 GG10813-PA 1..477 1..479 1513 57.4 Plus
Dere\GG24151-PA 847 GG24151-PA 1..476 1..477 1458 54.9 Plus
Dere\GG21650-PA 510 GG21650-PA 36..510 1..479 1305 51.6 Plus
Dere\amd-PA 510 GG21159-PA 1..478 1..478 1122 45 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2014-11-28 07:52:26
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH20147-PA 638 GH20147-PA 1..636 1..635 3117 92.9 Plus
Dgri\GH20148-PA 588 GH20148-PA 1..477 1..479 1514 56.8 Plus
Dgri\GH21773-PA 816 GH21773-PA 1..476 1..477 1417 52.8 Plus
Dgri\GH13483-PA 516 GH13483-PA 36..515 1..482 1378 51.9 Plus
Dgri\GH13435-PA 615 GH13435-PA 109..572 1..464 1134 44.6 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 07:52:21
Subject Length Description Subject Range Query Range Score Percent Strand
Tdc2-PA 637 CG30446-PA 1..637 1..637 3359 100 Plus
Tdc1-PA 587 CG30445-PA 1..482 1..484 1456 56.8 Plus
Hdc-PC 619 CG3454-PC 1..476 1..477 1407 55.1 Plus
Hdc-PD 847 CG3454-PD 1..476 1..477 1407 55.1 Plus
Hdc-PB 847 CG3454-PB 1..476 1..477 1407 55.1 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2014-11-28 07:52:28
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI20238-PA 659 GI20238-PA 1..659 1..637 3198 90.7 Plus
Dmoj\GI20239-PA 583 GI20239-PA 1..477 1..479 1494 56.4 Plus
Dmoj\GI19320-PA 817 GI19320-PA 1..476 1..477 1399 52.2 Plus
Dmoj\GI17235-PA 516 GI17235-PA 36..511 1..478 1360 51.7 Plus
Dmoj\GI13977-PA 507 GI13977-PA 1..491 1..486 1176 44.6 Plus
Blast to dper-all-translation-r1.3.fasta performed 2014-11-28 07:52:29
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL10988-PA 635 GL10988-PA 1..635 1..637 3282 95.9 Plus
Dper\GL10989-PA 593 GL10989-PA 1..477 1..479 1497 56.2 Plus
Dper\GL11582-PA 843 GL11582-PA 1..478 1..477 1419 54.5 Plus
Dper\GL21129-PA 515 GL21129-PA 41..501 1..464 1350 53.2 Plus
Dper\GL21186-PA 436 GL21186-PA 1..424 1..424 1091 46.9 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2014-11-28 07:52:31
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA15851-PA 635 GA15851-PA 1..635 1..637 3271 95.8 Plus
Dpse\GA15850-PA 593 GA15850-PA 1..477 1..479 1497 56.2 Plus
Dpse\GA17460-PA 843 GA17460-PA 1..478 1..477 1419 54.5 Plus
Dpse\Ddc-PA 515 GA10503-PA 41..501 1..464 1350 53.2 Plus
Dpse\amd-PA 510 GA10357-PA 1..502 1..508 1132 42.9 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2014-11-28 07:52:33
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM20861-PA 638 GM20861-PA 1..638 1..637 3405 99.2 Plus
Dsec\GM20862-PA 587 GM20862-PA 1..477 1..479 1504 57 Plus
Dsec\GM21194-PA 847 GM21194-PA 1..476 1..477 1459 54.9 Plus
Dsec\GM17029-PA 510 GM17029-PA 36..510 1..479 1332 51.4 Plus
Dsec\GM17326-PA 510 GM17326-PA 1..467 1..467 1110 45.2 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2014-11-28 07:52:36
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD10312-PA 416 GD10312-PA 1..405 1..405 2199 99.8 Plus
Dsim\GD10313-PA 587 GD10313-PA 1..477 1..479 1504 57 Plus
Dsim\GD10721-PA 847 GD10721-PA 1..476 1..477 1461 54.9 Plus
Dsim\Ddc-PA 510 GD21778-PA 36..510 1..479 1340 51.6 Plus
Dsim\amd-PA 510 GD24184-PA 1..467 1..467 1118 45.4 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2014-11-28 07:52:38
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ20190-PA 649 GJ20190-PA 1..649 1..637 3203 92.6 Plus
Dvir\GJ20191-PA 582 GJ20191-PA 1..477 1..479 1510 56.8 Plus
Dvir\GJ22198-PA 825 GJ22198-PA 1..476 1..477 1415 52.8 Plus
Dvir\Ddc-PA 504 GJ17995-PA 24..504 1..490 1363 51.2 Plus
Dvir\amd-PA 507 GJ18241-PA 1..493 1..488 1155 44.6 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2014-11-28 07:52:41
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK23145-PA 641 GK23145-PA 1..618 1..609 3035 91.4 Plus
Dwil\GK23146-PA 589 GK23146-PA 1..473 1..475 1517 57.5 Plus
Dwil\GK17782-PA 806 GK17782-PA 1..476 1..477 1455 54.9 Plus
Dwil\Ddc-PA 511 GK24237-PA 37..507 1..474 1349 51.9 Plus
Dwil\amd-PA 513 GK24791-PA 1..479 1..479 1139 45.5 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2014-11-28 07:52:42
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE24598-PA 632 GE24598-PA 1..628 1..628 3376 99.5 Plus
Dyak\GE24609-PA 587 GE24609-PA 1..477 1..479 1509 57 Plus
Dyak\GE19346-PA 849 GE19346-PA 1..476 1..477 1460 54.9 Plus
Dyak\GE12670-PA 513 GE12670-PA 39..513 1..479 1311 51.8 Plus
Dyak\GE13232-PA 510 GE13232-PA 1..478 1..478 1125 45 Plus

MIP05841.hyp Sequence

Translation from 146 to 2059

> MIP05841.hyp
MDSTEFRKRGMEMVEYICNYLETLNERRVTPSVEPGYLRHLLPPEAPQEP
EDWDQIMRDVEDKIMPGVTHWQHPRFHAYFPAGNSFPSILGDMLGDGIGC
IGFSWAASPACTELETIVLDWLGKAIGLPDHFLALKEGSTGGGVIQTSAS
ECVLVTMLAARAQALKRLKAQHPFVEEGHLLSKLMAYCSKEAHSCVEKAA
MICFVKLRILEPDDDASLRGQTIYEAMEEDELQGLVPFFVSTTLGTTGSC
AFDNLPEIGKQLQRFPGVWLHVDAAYAGNSFICPELKPLLKGIEYADSFN
TNPNKWLLTNFDCSTLWVRDRIRLTSALVVDPLYLKHGYSDAAIDYRHWG
VPLSRRFRSLKLWFVLRSYGISGLQHYIRHHIKLAKRFEELVLKDKRFEI
CNQVKLGLVCFRLKGSDKLNEKLLSIINESGKLHMVPASVGDRYIIRFCA
VAQNATAEDIDYAWDIIVDFANELLEKEQHDELSEIMNRKKQDTLAQKRS
FFVRMVSDPKIYNPAINKAGTPKLSMELPSPVVSRGSAPIIRTQSSVDHN
SWISWPLAFLFNSNNEEKGSNVSLRFRHLDTNVRPSSSRRNSGAGSSPSP
ENELDYVNVQQQQMEQRSPRRSPMAVRKASSTRDNLN*

MIP05841.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 14:49:13
Subject Length Description Subject Range Query Range Score Percent Strand
Tdc2-PA 637 CG30446-PA 1..637 1..637 3359 100 Plus
Tdc1-PA 587 CG30445-PA 1..482 1..484 1456 56.8 Plus
Hdc-PC 619 CG3454-PC 1..476 1..477 1407 55.1 Plus
Hdc-PD 847 CG3454-PD 1..476 1..477 1407 55.1 Plus
Hdc-PB 847 CG3454-PB 1..476 1..477 1407 55.1 Plus